DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and Fas3

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster


Alignment Length:623 Identity:124/623 - (19%)
Similarity:203/623 - (32%) Gaps:192/623 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 QAYITPNKPVVHVGNGVTLTCSANPPGWPVPQYRWFRDMDG---DIGNTQKILAQGPQY------ 468
            |..:.||..:::.|:...|.|            |:.|.::.   :|...||:|...|::      
  Fly    21 QVNVEPNTALLNEGDRTELLC------------RYGRSINYCRIEIPGEQKVLNLSPEWSKTPGF 73

  Fly   469 --------------SIPKAHLGSEGKYHCHAVNELGI------GKIATIILEVHQPPQFLAKLQQ 513
                          ||.:....:.|:..|    .||:      |.|..::  ..:|.|.:.:|..
  Fly    74 TYFGAGLTAGQCGVSIERVKASNNGQVKC----SLGVEGEELSGTIDLVV--ALRPQQPIIELLS 132

  Fly   514 HMTRRVG----DVDYAVTCSAK-GKPTPQIRWIKDGTEILPTRKMFDIRTTP----TDAGGGVVA 569
            ...|. |    ..::...||.: |:|...|.|..|.   :|..|    ||||    :.....|..
  Fly   133 RPNRE-GYFNEGTEFRARCSVRDGRPPANISWYIDN---MPANK----RTTPLEVMSSTNDNVEL 189

  Fly   570 VQSILRFRGKARPNGNQLLPNDRGLYTCLYENDVNSA---NSSMHLRIEHEPIVIHQYNKVAYD- 630
            ..|:...:....|..:    |.:.:....::.|..|.   .::..:.:.:.|  :||.:...|. 
  Fly   190 STSVQEIQWHLSPEDS----NRKLVCRSHHQTDRESVPPQEAAYIINVRYAP--VHQPDAAVYGL 248

  Fly   631 -LRESAEVVCRVQAYPKPEFQWQ-----YGNNPSPLTMSSDGHYE-ISTRMENNDVYTSILRIAH 688
             |..:|.|...::|.|:|:.:|.     .|..      .:||.|. ...:...||.|...|.||.
  Fly   249 YLEHTAIVNITIRASPQPKIEWTIDGAIVGQG------RTDGRYSAYEPQYLGNDEYNVTLAIAG 307

  Fly   689 LQHSDYGE-YICRAVNPLDSIRAPIRLQPKGSP-------------------------------- 720
            |...|..: |..||.|.|......:|:.....|                                
  Fly   308 LTLEDTTKIYNLRASNELGLTDYQVRISSSSKPPSSSLDVAAIVGIVVAVAVLVLVVLLIVFARA 372

  Fly   721 -----------EKPTNL----KILEV------GHNYAVLNWTPGFNGGFMSTKYLVSYRRVATPR 764
                       :.|||.    |.||:      |.|.|:|. ||  ||             :....
  Fly   373 TGRWCFGGKSIKTPTNETQIDKQLELGAQQNHGQNVALLE-TP--NG-------------ITLLG 421

  Fly   765 EQTLSDCSGNGYIPSYQISSSSSNSNH---EWIEFNCFKE----NPCKLAPLDQHQSYMFKVYAL 822
            ...|.:.:|||.....|...|....:|   :..|:...:|    || ...||  ....|.:....
  Fly   422 ASKLREVNGNGNGNGQQDRLSVERRHHDEDDSFEYGTDRESSVYNP-TTRPL--KSILMSQAAGR 483

  Fly   823 NSKGTSGYSNEILATTKVSKIPPPLHVSYDPNSHVLGINVAATCLSLIAVVESLVTRDATVPMWE 887
            ||:.::...:|                 .:.|:.:|...      :.:.:.||..:|.......|
  Fly   484 NSRSSASDKDE-----------------GNENADLLQKG------NQLGIPESRFSRWLPKDQRE 525

  Fly   888 IVETLTLLPSGSETTFKEAIINHVSRP--AHYTTATTS 923
            ::|...:|.||...:...|......||  ...|||||:
  Fly   526 LIEKQAMLLSGRGKSTAPATPPKPQRPPMGTTTTATTT 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250
Ig strand B 148..152 CDD:409353
Ig strand C 162..166 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 238..313 CDD:472250
Ig strand B 250..254 CDD:409353
Ig strand C 264..268 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Ig strand G 306..309 CDD:409353
Ig_3 316..385 CDD:464046
Ig_2 416..501 CDD:464026 20/113 (18%)
Ig 523..614 CDD:472250 19/98 (19%)
Ig strand B 524..528 CDD:409568 0/3 (0%)
Ig strand C 537..541 CDD:409568 1/3 (33%)
Ig strand E 566..570 CDD:409568 1/3 (33%)
Ig strand F 594..599 CDD:409568 0/4 (0%)
Ig strand G 607..610 CDD:409568 0/2 (0%)
Ig_3 618..703 CDD:464046 26/93 (28%)
FN3 720..838 CDD:238020 32/177 (18%)
Fas3NP_001097174.1 C2-set_2 141..222 CDD:400489 18/91 (20%)
Ig strand B 146..150 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 194..198 CDD:409353 0/3 (0%)
Ig strand F 208..213 CDD:409353 0/4 (0%)
Ig strand G 226..229 CDD:409353 0/2 (0%)
Ig 253..326 CDD:472250 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.