DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and bsg

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_937785.2 Gene:bsg / 337692 ZFINID:ZDB-GENE-030131-9638 Length:392 Species:Danio rerio


Alignment Length:400 Identity:87/400 - (21%)
Similarity:139/400 - (34%) Gaps:111/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 CNVTANPSPINVEWLKEG-APDFRYTGELLT------------LGSVRAEHA------------- 376
            |.|..||.|....|..|| .||     |::|            :.:...:||             
Zfish    45 CEVIGNPIPEVQWWFIEGEEPD-----EIITQLFDGAREDRVHINATYIDHATSSLILTNLTFND 104

  Fly   377 -GNYICRSVN------IMQPFSSKRVEGVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTCS 434
             |.|.||:.|      :..|...|.:....|    ::|..|   |.|. ..|.|:.....||:|:
Zfish   105 TGVYECRASNDPDRNDLRTPPKVKWIRSQAN----VIVFER---ATIM-TSPEVNNATSATLSCN 161

  Fly   435 ANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYS----------IPKAHLGSEGKYHCHAVNEL 489
            ...|..|:..:.|       :.|.:||   ...||          |.||.....|.|.|..:.| 
Zfish   162 LTNPSSPIKGHYW-------VKNGKKI---EESYSTNTDSYAEHFIEKADYHHSGIYTCVFLTE- 215

  Fly   490 GIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAV-TCSAKGKPTP-QIRWIK--DGTEILP- 549
               ..|...:||...|...|   ...:....:.|.|| :|.::|.|:| ...|.|  |..|..| 
Zfish   216 ---PQANATIEVKALPHIKA---SKSSENANEKDKAVLSCGSQGYPSPTDWSWFKLPDAGERTPI 274

  Fly   550 ---TRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPNGNQLLPNDRGLYTCLYENDVNSANSSMH 611
               |...::|::||...   .:.|:.:             .:..|.|.|.|...::|.:....:.
Zfish   275 FNGTDDKYEIKSTPNKT---TLYVKDL-------------DINEDMGFYQCQGTSEVGTGTDDIQ 323

  Fly   612 LRIEHEPIVIHQYNKVAYDLRESAEVVCRVQ---AYPK----PEFQWQYGNNPSPL-TMSSDGHY 668
            ||:..:...:..:..:.      |||:..:.   .|.|    .|......:..:|| :.|:..|.
Zfish   324 LRVRSQLAALWPFLGIV------AEVIILITIIFVYEKRRKPDEINDDDDSGSAPLKSNSATNHK 382

  Fly   669 EISTRMENND 678
            :.:.|..|::
Zfish   383 DKNVRQRNSN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250
Ig strand B 148..152 CDD:409353
Ig strand C 162..166 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 238..313 CDD:472250
Ig strand B 250..254 CDD:409353
Ig strand C 264..268 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Ig strand G 306..309 CDD:409353
Ig_3 316..385 CDD:464046 18/73 (25%)
Ig_2 416..501 CDD:464026 22/94 (23%)
Ig 523..614 CDD:472250 23/98 (23%)
Ig strand B 524..528 CDD:409568 2/4 (50%)
Ig strand C 537..541 CDD:409568 0/3 (0%)
Ig strand E 566..570 CDD:409568 0/3 (0%)
Ig strand F 594..599 CDD:409568 2/4 (50%)
Ig strand G 607..610 CDD:409568 0/2 (0%)
Ig_3 618..703 CDD:464046 12/68 (18%)
FN3 720..838 CDD:238020
bsgNP_937785.2 Ig 24..140 CDD:472250 23/103 (22%)
Ig strand B 41..45 CDD:409534 87/399 (22%)
Ig strand C 54..58 CDD:409534 0/3 (0%)
Ig strand E 93..97 CDD:409534 0/3 (0%)
Ig strand F 107..112 CDD:409534 2/4 (50%)
Ig strand G 131..134 CDD:409534 0/2 (0%)
Ig 156..211 CDD:409353 16/64 (25%)
Ig strand B 156..160 CDD:409353 2/3 (67%)
Ig strand C 169..175 CDD:409353 1/12 (8%)
Ig strand F 207..211 CDD:409353 1/3 (33%)
IG_like 235..326 CDD:214653 23/106 (22%)
Ig strand B 245..249 CDD:409353 2/3 (67%)
Ig strand C 259..263 CDD:409353 0/3 (0%)
Ig strand E 291..295 CDD:409353 0/6 (0%)
Ig strand F 306..311 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.