Sequence 1: | NP_608812.3 | Gene: | fred / 33613 | FlyBaseID: | FBgn0051774 | Length: | 1447 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572814.1 | Gene: | Fpgs / 32212 | FlyBaseID: | FBgn0030407 | Length: | 572 | Species: | Drosophila melanogaster |
Alignment Length: | 262 | Identity: | 48/262 - (18%) |
---|---|---|---|
Similarity: | 79/262 - (30%) | Gaps: | 94/262 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 752 KYLVSYR-------RVATPREQTLSDCSGNGYIPSYQISSSSSNSNHEW--------IEFNCFKE 801
Fly 802 NPCKL-----------------------APLDQHQSYMFKVYALNSKGTSGYSNEILATTKVSKI 843
Fly 844 PPPLHVSYDPNSHVLGINVAATCLSLIAVVESLVTRDA-TVPMWEIVETLTLLPSGSETTFKEAI 907
Fly 908 INHVSRPAHYTTATTSGRS-----------LGVG-GGSH----------------LGEDRTMALA 944
Fly 945 ET 946 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fred | NP_608812.3 | Ig | 29..126 | CDD:299845 | |
IG_like | 141..228 | CDD:214653 | |||
Ig | 147..228 | CDD:299845 | |||
I-set | 232..313 | CDD:254352 | |||
IGc2 | 250..302 | CDD:197706 | |||
IG_like | 323..385 | CDD:214653 | |||
IGc2 | 330..385 | CDD:197706 | |||
Ig_2 | 416..501 | CDD:290606 | |||
IG_like | 418..501 | CDD:214653 | |||
I-set | 505..612 | CDD:254352 | |||
Ig | 526..611 | CDD:143165 | |||
IG_like | 633..715 | CDD:214653 | |||
Ig | 635..713 | CDD:143165 | |||
FN3 | 720..838 | CDD:238020 | 22/123 (18%) | ||
Fpgs | NP_572814.1 | PLN02881 | 90..554 | CDD:215476 | 34/216 (16%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0285 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |