DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and NECTIN3

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_011510965.1 Gene:NECTIN3 / 25945 HGNCID:17664 Length:580 Species:Homo sapiens


Alignment Length:337 Identity:72/337 - (21%)
Similarity:128/337 - (37%) Gaps:61/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LFENVAIGDVQLNSNYRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKGTGADVHQEFYNLTV 125
            ||:|.::.|..:.                 :.|..:: |:|::.|:......|.  .|....:||
Human   153 LFKNYSLNDATIT-----------------LHNIGFS-DSGKYICKAVTFPLGN--AQSSTTVTV 197

  Fly   126 LTAPHPPMVTPGNLAVATEEKPLELTCSSIGGSPDPMITWYREGSTVPLQSYALKGGSKNHYTNA 190
            |..|...::...:..:....:.:...|.:..|.|...|.|  ||....::|      :...:.|.
Human   198 LVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDW--EGDLGEMES------TTTSFPNE 254

  Fly   191 TLQIV------PRRADDGAKYKCVVWNRAMPEGHMLETSVTLNVNYYPRVEV-GPQNPLKVERDH 248
            |..|:      |.|...|.:..|||.:.|:.:.  :..|..|::.|.|.|.| |......|.|..
Human   255 TATIISQYKLFPTRFARGRRITCVVKHPALEKD--IRYSFILDIQYAPEVSVTGYDGNWFVGRKG 317

  Fly   249 VAKLDCRVDAKPMVSNVRWSR-NGQY-----VSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEK 307
            | .|.|..||.|......||| :||:     .|....|.::.:..:::|.|.|...|.||:..::
Human   318 V-NLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQ 381

  Fly   308 DIVLDVLYPPIVFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVR 372
            .::. :..||              .|..::..:..:||..::|.|........:  .|.||.:::
Human   382 KVIY-ISDPP--------------TTTTLQPTIQWHPSTADIEDLATEPKKLPF--PLSTLATIK 429

  Fly   373 AEHAGNYICRSV 384
            .:.....|...|
Human   430 DDTIATIIASVV 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250 20/101 (20%)
Ig strand B 148..152 CDD:409353 0/3 (0%)
Ig strand C 162..166 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 1/4 (25%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 238..313 CDD:472250 21/80 (26%)
Ig strand B 250..254 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Ig_3 316..385 CDD:464046 12/69 (17%)
Ig_2 416..501 CDD:464026
Ig 523..614 CDD:472250
Ig strand B 524..528 CDD:409568
Ig strand C 537..541 CDD:409568
Ig strand E 566..570 CDD:409568
Ig strand F 594..599 CDD:409568
Ig strand G 607..610 CDD:409568
Ig_3 618..703 CDD:464046
FN3 720..838 CDD:238020
NECTIN3XP_011510965.1 IgV_1_Nectin-3_like 89..198 CDD:409470 11/64 (17%)
FR1 89..112 CDD:409470
Ig strand A 89..93 CDD:409470
Ig strand A' 95..99 CDD:409470
Ig strand B 104..112 CDD:409470
CDR1 113..117 CDD:409470
FR2 118..124 CDD:409470
Ig strand C 119..124 CDD:409470
CDR2 125..144 CDD:409470
Ig strand C' 134..139 CDD:409470
Ig strand C' 141..145 CDD:409470
FR3 145..183 CDD:409470 8/47 (17%)
Ig strand D 152..156 CDD:409470 2/2 (100%)
Ig strand E 161..168 CDD:409470 1/23 (4%)
Ig strand F 175..183 CDD:409470 2/7 (29%)
CDR3 184..187 CDD:409470 0/2 (0%)
Ig strand G 187..197 CDD:409470 2/11 (18%)
FR4 188..198 CDD:409470 2/11 (18%)
IgC1_2_Nectin-3-4_like 201..296 CDD:409501 21/104 (20%)
Ig strand A 201..207 CDD:409501 1/5 (20%)
Ig strand B 220..227 CDD:409501 1/6 (17%)
Ig strand C 232..238 CDD:409501 2/7 (29%)
Ig strand C' 240..242 CDD:409501 0/1 (0%)
Ig strand D 244..251 CDD:409501 1/12 (8%)
Ig strand E 256..264 CDD:409501 1/7 (14%)
Ig strand F 274..281 CDD:409501 3/6 (50%)
Ig strand G 287..293 CDD:409501 1/7 (14%)
Ig 300..386 CDD:472250 25/87 (29%)
Ig strand B 318..322 CDD:409353 2/4 (50%)
Ig strand C 332..336 CDD:409353 0/3 (0%)
Ig strand E 351..356 CDD:409353 1/4 (25%)
Ig strand F 366..371 CDD:409353 2/4 (50%)
Ig strand G 381..384 CDD:409353 0/2 (0%)
TM_EGFR-like 435..463 CDD:213052 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.