DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and CG30350

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:204 Identity:37/204 - (18%)
Similarity:74/204 - (36%) Gaps:69/204 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 PCKLAPLDQ----HQSYMFKVYALNSKGTSGYSNEIL----ATTKVS--KIPPPLHVSYD----- 852
            |..|..|::    ::.:..::..:||:..||.|::.:    ::|.|:  ::||.....|:     
  Fly   135 PMALLTLEKLERDNRDFGRRILEVNSEVDSGLSDKRMREGRSSTPVAPLELPPQAMAKYEAFNIP 199

  Fly   853 -PNS--------------------------HVLGINVAATCLSLIAVVESLVTRDATVPM----- 885
             |.|                          .|:.:...|..|.::.:::|.:....:..|     
  Fly   200 LPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLF 264

  Fly   886 ---WEIVETLTLLPSGS----ETTFKEAIINH-------------VSRPAHYTTATTSGRSLGVG 930
               |  :||..:|.|.|    ...:...:|:|             |:...|:.:...|.:.|.|.
  Fly   265 PNLW--LETDLMLSSDSLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVV 327

  Fly   931 GGSHLGEDR 939
            .||.:|..|
  Fly   328 NGSRVGFGR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352
IGc2 250..302 CDD:197706
IG_like 323..385 CDD:214653
IGc2 330..385 CDD:197706
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020 8/42 (19%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 3/19 (16%)
cyclophilin 212..369 CDD:294131 22/127 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.