DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and Fpgs

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_006497759.2 Gene:Fpgs / 14287 MGIID:95576 Length:592 Species:Mus musculus


Alignment Length:517 Identity:103/517 - (19%)
Similarity:156/517 - (30%) Gaps:224/517 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 ITWYREG--STVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGHMLETSVT 225
            ::|.|..  ||:.|.:.:.:|.:........:...|...:.|.:|:..|        ..|.|..|
Mouse     1 MSWARSRLCSTLSLAAVSARGATTEGAARRGMSAWPAPQEPGMEYQDAV--------RTLNTLQT 57

  Fly   226 LNVNYYPRVE---VGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNR 287
             |.:|..:|:   ..||..|:....::|:...:|:                       .:.|:|.
Mouse    58 -NASYLEQVKRQRSDPQAQLEAMEMYLARSGLQVE-----------------------DLNRLNI 98

  Fly   288 HHA----GK-YTCS------ADNGLGKTG-----------------EKDIVLDV-------LYPP 317
            .|.    || .||:      .:.|| |||                 .|.|..::       ||..
Mouse    99 IHVTGTKGKGSTCAFTERILRNYGL-KTGFFSSPHMVQVRERIRINGKPISPELFTKHFWCLYNQ 162

  Fly   318 I------------------------VFIESKTHEA--EEGE------TVLIRCNVTANPSPINVE 350
            :                        ||::.|...|  |.|.      |.:||..|....|.:.::
Mouse   163 LEEFKDDSHVSMPSYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAFDCTNIIRKPVVCGVSSLGID 227

  Fly   351 -------------W-----LKEGAPDFRYT---GELLTLGSVRAEHAG--NYICRSVNIMQPFS- 391
                         |     .|.|.|.|...   |.|..|.. ||:..|  .|:|..:..::... 
Mouse   228 HTSLLGDTVEKIAWQKGGIFKPGVPAFTVVQPEGPLAVLRD-RAQQIGCPLYLCPPLEALEEVGL 291

  Fly   392 --SKRVEGV---GNSTVALLVRH----------------------RPGQAYITPNKPVV----HV 425
              |..:||.   .|:.:||.:.|                      ||...:..|..||.    |:
Mouse   292 PLSLGLEGAHQRSNAALALQLAHCWLERQDHQDSHPTDIQELKVSRPSIRWQLPLAPVFRPTPHM 356

  Fly   426 GNGVTLTCSANPPGWPVPQYRWFRDMDGDIGNTQKILAQGP-QYSIPKAHL-------------- 475
            ..|:..|.      ||              |.|| ||.:|| .:.:..||.              
Mouse   357 RRGLRDTV------WP--------------GRTQ-ILQRGPLTWYLDGAHTTSSVQACVHWYRQS 400

  Fly   476 ---------GSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVTC 528
                     |||  .|....|..| .:.:..:|::.||.||               ||||.|
Mouse   401 LERSKRTDGGSE--VHILLFNSTG-DRDSAALLKLLQPCQF---------------DYAVFC 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653 13/66 (20%)
Ig 147..228 CDD:299845 13/66 (20%)
I-set 232..313 CDD:254352 20/111 (18%)
IGc2 250..302 CDD:197706 10/62 (16%)
IG_like 323..385 CDD:214653 22/92 (24%)
IGc2 330..385 CDD:197706 19/83 (23%)
Ig_2 416..501 CDD:290606 24/112 (21%)
IG_like 418..501 CDD:214653 24/110 (22%)
I-set 505..612 CDD:254352 7/24 (29%)
Ig 526..611 CDD:143165 2/3 (67%)
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
FpgsXP_006497759.2 PLN02881 44..586 CDD:215476 95/474 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.