DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and side

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_061499735.1 Gene:side / 1281499 VectorBaseID:AGAMI1_000974 Length:949 Species:Anopheles gambiae


Alignment Length:150 Identity:32/150 - (21%)
Similarity:50/150 - (33%) Gaps:60/150 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 ERYSH---LRTTNQDEASHAVEIGWQNDRNTTYGCYGYLISTRGVVSSASCLLEKGVLPNIVRIG 681
            |:..|   ||.:.:...||.:.  |    :.:..|:...|..||||                 :|
Mosquito     3 EKKGHEIPLRNSRKKWLSHLLR--W----SVSSICWISYIIYRGVV-----------------VG 44

  Fly   682 GMK--SLNESSIIRVENI--------------------------AIHPNYNAKS---IAHNIAVV 715
            .||  ..|...||...||                          ||.|.::.||   ..:.|..:
Mosquito    45 QMKFDPRNRKMIIHPRNIWTKRISLLLKILAMLWDYYFIQYLCSAILPIFSNKSERFFNNLIEAI 109

  Fly   716 KLELAVDPTANIFPTCLWQN 735
            .::|::..||.::.   |.|
Mosquito   110 AVQLSLWNTARLYS---WLN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250
Ig strand B 148..152 CDD:409353
Ig strand C 162..166 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 238..313 CDD:472250
Ig strand B 250..254 CDD:409353
Ig strand C 264..268 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Ig strand G 306..309 CDD:409353
Ig_3 316..385 CDD:464046
Ig_2 416..501 CDD:464026
Ig 523..614 CDD:472250
Ig strand B 524..528 CDD:409568
Ig strand C 537..541 CDD:409568
Ig strand E 566..570 CDD:409568
Ig strand F 594..599 CDD:409568
Ig strand G 607..610 CDD:409568
Ig_3 618..703 CDD:464046 24/113 (21%)
FN3 720..838 CDD:238020 3/15 (20%)
sideXP_061499735.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.