| Sequence 1: | NP_608812.3 | Gene: | fred / 33613 | FlyBaseID: | FBgn0051774 | Length: | 1447 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_061499735.1 | Gene: | side / 1281499 | VectorBaseID: | AGAMI1_000974 | Length: | 949 | Species: | Anopheles gambiae |
| Alignment Length: | 150 | Identity: | 32/150 - (21%) |
|---|---|---|---|
| Similarity: | 50/150 - (33%) | Gaps: | 60/150 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 620 ERYSH---LRTTNQDEASHAVEIGWQNDRNTTYGCYGYLISTRGVVSSASCLLEKGVLPNIVRIG 681
Fly 682 GMK--SLNESSIIRVENI--------------------------AIHPNYNAKS---IAHNIAVV 715
Fly 716 KLELAVDPTANIFPTCLWQN 735 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| fred | NP_608812.3 | Ig | 132..228 | CDD:472250 | |
| Ig strand B | 148..152 | CDD:409353 | |||
| Ig strand C | 162..166 | CDD:409353 | |||
| Ig strand E | 190..194 | CDD:409353 | |||
| Ig strand F | 204..209 | CDD:409353 | |||
| Ig strand G | 221..224 | CDD:409353 | |||
| Ig | 238..313 | CDD:472250 | |||
| Ig strand B | 250..254 | CDD:409353 | |||
| Ig strand C | 264..268 | CDD:409353 | |||
| Ig strand E | 278..282 | CDD:409353 | |||
| Ig strand F | 292..297 | CDD:409353 | |||
| Ig strand G | 306..309 | CDD:409353 | |||
| Ig_3 | 316..385 | CDD:464046 | |||
| Ig_2 | 416..501 | CDD:464026 | |||
| Ig | 523..614 | CDD:472250 | |||
| Ig strand B | 524..528 | CDD:409568 | |||
| Ig strand C | 537..541 | CDD:409568 | |||
| Ig strand E | 566..570 | CDD:409568 | |||
| Ig strand F | 594..599 | CDD:409568 | |||
| Ig strand G | 607..610 | CDD:409568 | |||
| Ig_3 | 618..703 | CDD:464046 | 24/113 (21%) | ||
| FN3 | 720..838 | CDD:238020 | 3/15 (20%) | ||
| side | XP_061499735.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||