DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC1272537

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_311453.2 Gene:LOC1272537 / 1272537 VectorBaseID:AGAMI1_004034 Length:144 Species:Anopheles gambiae


Alignment Length:113 Identity:32/113 - (28%)
Similarity:51/113 - (45%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSLDTREGVDLVLKCRFTEHYDSTDFTFYWARWT--CCPTLFENVAIG--DVQLNSNYRLDFRPS 83
            :.::..:|.::||:|.. ||....      .:||  .....|.|..:|  ...||.|:      |
Mosquito    39 NDIEANQGDEVVLRCEI-EHLAGR------VQWTKDGFALGFSNEIVGYPRFSLNQNH------S 90

  Fly    84 RGIYDLQIKNTSYNRDNGRFECRIKAKGTGADVH--QEFYNLTVLTAP 129
            .|:|:|:|.||||: |...::|::   |.....|  :....||||..|
Mosquito    91 DGVYNLRITNTSYD-DAALYQCQV---GPAKHNHPIRAQAKLTVLATP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250
Ig strand B 148..152 CDD:409353
Ig strand C 162..166 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 238..313 CDD:472250
Ig strand B 250..254 CDD:409353
Ig strand C 264..268 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Ig strand G 306..309 CDD:409353
Ig_3 316..385 CDD:464046
Ig_2 416..501 CDD:464026
Ig 523..614 CDD:472250
Ig strand B 524..528 CDD:409568
Ig strand C 537..541 CDD:409568
Ig strand E 566..570 CDD:409568
Ig strand F 594..599 CDD:409568
Ig strand G 607..610 CDD:409568
Ig_3 618..703 CDD:464046
FN3 720..838 CDD:238020
LOC1272537XP_311453.2 IG_like 38..130 CDD:214653 28/107 (26%)
Ig strand B 49..53 CDD:409353 2/3 (67%)
Ig strand C 61..65 CDD:409353 0/9 (0%)
Ig strand E 94..98 CDD:409353 2/3 (67%)
Ig strand F 108..113 CDD:409353 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.