DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC1271141

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_061513772.1 Gene:LOC1271141 / 1271141 VectorBaseID:AGAMI1_002287 Length:360 Species:Anopheles gambiae


Alignment Length:363 Identity:76/363 - (20%)
Similarity:117/363 - (32%) Gaps:140/363 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NGRFECRIKAKGTGADVHQEFYNLTV---LTAPHPPMV-TPGNLAVATEE----KPLELTCSSIG 156
            :|.|||.:..||   ..::...|:.:   ..||.||:: ...|:.....|    |.:.:.|.|..
Mosquito   100 DGPFECTVSVKG---QTYKGQINIALSGEAVAPEPPVIELASNVDSRNGEFEFGKKVTMKCVSRN 161

  Fly   157 GSPDPMITWYREGSTVPLQSYALKGGSKNHYTNATLQIVPRRA----DDGAKYKCVVWNRAMPEG 217
            |.|...::||.:|..:.....|....:.|..|  |:|.:.|||    |:..|..|...:.|.|.|
Mosquito   162 GWPGAKLSWYLDGVKLTEDVGAEFSETSNRRT--TVQQIYRRAIAVEDNRKKVTCRAEHTAYPGG 224

  Fly   218 HMLETSVTLNVNYYPRVEVGPQNPLKV------ERDHVAKLDCRVDAKP-----MVSNVRWSRNG 271
            .| |||:                |:|:      |:..|.|.:.:...||     .||:|...|||
Mosquito   225 FM-ETSL----------------PIKLKKVYTNEKPEVQKEELKESVKPKPPQLTVSSVVAQRNG 272

  Fly   272 QYVSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTHEAEEGETVLI 336
            .:                                                       :.|..:::
Mosquito   273 AF-------------------------------------------------------KVGSNLVV 282

  Fly   337 RC-NVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKRVEGVGN 400
            :| :...|| |....|.        ...:|:..|                :..||:||...|   
Mosquito   283 QCVSKDGNP-PAGFLWF--------LNDQLIYEG----------------LSAPFTSKSSRG--- 319

  Fly   401 STVALLVRHRPGQAYITPNKPVVHVGNGVTLTCSANPP 438
            |||         |..:|  .|:....:|..|.|.|..|
Mosquito   320 STV---------QQTLT--LPLKQTDDGKVLICKARHP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250 29/104 (28%)
Ig strand B 148..152 CDD:409353 0/3 (0%)
Ig strand C 162..166 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 2/2 (100%)
Ig 238..313 CDD:472250 13/85 (15%)
Ig strand B 250..254 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 1/3 (33%)
Ig strand E 278..282 CDD:409353 0/3 (0%)
Ig strand F 292..297 CDD:409353 0/4 (0%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Ig_3 316..385 CDD:464046 8/69 (12%)
Ig_2 416..501 CDD:464026 7/23 (30%)
Ig 523..614 CDD:472250
Ig strand B 524..528 CDD:409568
Ig strand C 537..541 CDD:409568
Ig strand E 566..570 CDD:409568
Ig strand F 594..599 CDD:409568
Ig strand G 607..610 CDD:409568
Ig_3 618..703 CDD:464046
FN3 720..838 CDD:238020
LOC1271141XP_061513772.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.