DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC116406858

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_031747697.1 Gene:LOC116406858 / 116406858 XenbaseID:XB-GENE-29092259 Length:455 Species:Xenopus tropicalis


Alignment Length:451 Identity:103/451 - (22%)
Similarity:163/451 - (36%) Gaps:121/451 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 HQEFY--NLTVLTAPHPPMV-----------TPGNLAVA--------------TEEKPLELTCSS 154
            |::|:  .||.|||..|.:|           |...:|.:              |...|.|....|
 Frog    14 HEQFWGLELTPLTAGKPQIVHCVCRRYLLLCTASYIAESGAAVRPVVSLSPNWTPIFPGESVTLS 78

  Fly   155 IGGSPDPM----ITWYREGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCVVW--NRA 213
            ...:|...    .:||.||..:       :|..:      :|.|.|.|..|...|:|...  .|:
 Frog    79 CNVAPTAQGNLGYSWYWEGQRI-------RGDQQ------SLFIQPARETDSGDYQCQAGASERS 130

  Fly   214 MPEGHMLETSVTLNVNYYPRVEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRN-------- 270
            .|        |||::.|.|.:...|  |...|.|   .|..|...:|...    :||        
 Frog   131 AP--------VTLDIYYDPLILQAP--PAVYEGD---SLTLRCQRRPGYD----TRNPVFYKDNY 178

  Fly   271 --GQYVSATPTHTIYRVNRHHAGKYTCSADNGLGKT--GEKDIVLDVLYPPIVFIESKTHEAEEG 331
              |..||.:..| |.||:...:|.|.|...:.. ||  .|..|.:..|:.. ..|....:...||
 Frog   179 AIGSPVSGSELH-IGRVDVTASGTYLCEEKSSF-KTLKAENYISVSELFSS-PHINVSQYYLIEG 240

  Fly   332 ETVLIRCNVTANP----SPINVEWLKEG--APDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPF 390
            :.:.|.|:...:|    :.:...:.:.|  ...|..:.: ..:.||:.|.:|||.|   .:..|.
 Frog   241 DHMTITCDTKLSPHRETTELQFAFYRNGHNVQGFSLSNQ-YGVPSVQLEDSGNYTC---EVQTPT 301

  Fly   391 SSKRVEGVGNSTVALLVRHRPGQAYI-------TPNKPV----VHVGNGVTLTCSA--NPPGWPV 442
            .|              ||.|..:|:|       :|...|    |..|:.:|:||..  :|.....
 Frog   302 GS--------------VRKRSREAHIHIQELFSSPQIKVSSDQVTEGDHMTITCDTELHPHRETT 352

  Fly   443 P-QYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVH 502
            . |:.::|:     |:..:..:...||.:|.|.|...|||.|......|..:..:.::.:|
 Frog   353 ELQFAFYRN-----GHNVQGFSLSNQYGVPSAQLEDSGKYTCEVQTPTGSVRKRSSMVHIH 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250 25/126 (20%)
Ig strand B 148..152 CDD:409353 1/3 (33%)
Ig strand C 162..166 CDD:409353 0/7 (0%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 238..313 CDD:472250 23/86 (27%)
Ig strand B 250..254 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 1/2 (50%)
Ig_3 316..385 CDD:464046 15/74 (20%)
Ig_2 416..501 CDD:464026 22/98 (22%)
Ig 523..614 CDD:472250
Ig strand B 524..528 CDD:409568
Ig strand C 537..541 CDD:409568
Ig strand E 566..570 CDD:409568
Ig strand F 594..599 CDD:409568
Ig strand G 607..610 CDD:409568
Ig_3 618..703 CDD:464046
FN3 720..838 CDD:238020
LOC116406858XP_031747697.1 Ig 58..137 CDD:472250 22/99 (22%)
Ig strand B 75..79 CDD:409410 0/3 (0%)
Ig strand C 89..94 CDD:409410 0/4 (0%)
Ig strand E 105..109 CDD:409410 1/9 (11%)
Ig strand F 119..124 CDD:409410 2/4 (50%)
Ig strand G 130..133 CDD:409410 1/10 (10%)
Ig 142..>204 CDD:472250 18/71 (25%)
Ig strand B 156..160 CDD:409411 1/3 (33%)
Ig strand C 170..174 CDD:409411 1/3 (33%)
Ig strand E 187..191 CDD:409411 1/4 (25%)
ig 233..308 CDD:395002 18/92 (20%)
Ig strand B 243..247 CDD:409411 1/3 (33%)
Ig strand C 261..265 CDD:409411 0/3 (0%)
Ig strand E 278..282 CDD:409411 0/4 (0%)
Ig strand F 292..302 CDD:409411 4/12 (33%)
Ig_2 322..409 CDD:464026 22/92 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.