DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC110439989

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_021333843.1 Gene:LOC110439989 / 110439989 -ID:- Length:272 Species:Danio rerio


Alignment Length:284 Identity:73/284 - (25%)
Similarity:112/284 - (39%) Gaps:45/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 EEKPLELTC-SSIGGSPDPMITWYREGSTVPLQSYALKGGSKNHYTNAT----LQIVPRRADDGA 203
            |...:.||| ||...:..|...|||...|:               |..|    |.:.|.|.:|..
Zfish    25 EGDSVRLTCRSSCELTDTPTFIWYRNSHTL---------------TEGTIGDKLILNPVRREDAG 74

  Fly   204 KYKCVVWNRAMPEGHMLET-SVTLNVNYYPR-VEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVR 266
            :|:|.|      .||.|.: .|.|||.|.|: |.|.......:.......|.|..|:.| .:.:.
Zfish    75 RYRCAV------HGHTLTSPEVYLNV
TYPPKSVSVSISGSAVIMSGDSVTLSCSSDSNP-PAEIH 132

  Fly   267 WSRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTHEA--E 329
            |.:...|:.:.....|.:::...:|:|.|...|..|......:.|||.|||.....|....|  .
Zfish   133 WFKGKTYIGSERIFNISKISSDDSGEYKCKTRNDHGGKYSYPVTLDV
QYPPRNVSVSINGSAVIM 197

  Fly   330 EGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKR 394
            .|::|.:.|...:||..:|..|.||.......:|:     |..|..:|.:.|.:.|   |..::|
Zfish   198 SGDSVSLMCISDSNPPALNFSWFKENQSSAVGSGQ-----SFSAVQSGRFYCEAHN---PHGAQR 254

  Fly   395 VEGVGNSTVALLVRHRPGQAYITP 418
                 :..|.:.|:.:...| :||
Zfish   255 -----SDAVTVTVKGKADHA-LTP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653 25/89 (28%)
Ig 147..228 CDD:299845 24/86 (28%)
I-set 232..313 CDD:254352 16/81 (20%)
IGc2 250..302 CDD:197706 11/51 (22%)
IG_like 323..385 CDD:214653 16/63 (25%)
IGc2 330..385 CDD:197706 14/54 (26%)
Ig_2 416..501 CDD:290606 2/3 (67%)
IG_like 418..501 CDD:214653 1/1 (100%)
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC110439989XP_021333843.1 IG_like 19..94 CDD:214653 25/89 (28%)
Ig_2 108..179 CDD:316418 13/71 (18%)
Ig_2 193..262 CDD:316418 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.