DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC110439988

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_021333834.1 Gene:LOC110439988 / 110439988 -ID:- Length:213 Species:Danio rerio


Alignment Length:226 Identity:48/226 - (21%)
Similarity:74/226 - (32%) Gaps:78/226 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 DGAKYKCVVWNRAMPEGHMLETSVTLNVN--YYPRVEV--GPQNPLKVERDHVAKLDCRVDAKPM 261
            ||.:.....|::  .:|..:.....|:|:  |..|::.  ..|....|...||.|.|........
Zfish    40 DGLQIMRAFWHK--DQGIQVVEPPDLSVDSEYSQRLQYLGDKQQNHTVRLSHVTKKDEHEYYFRF
 102

  Fly   262 VSNVRWSRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTH 326
            ::||             ||..:                    ||...::|.|....:...|..| 
Zfish   103 ITNV-------------THEKW--------------------TGRPGVILSVTDLQLESPERVT- 133

  Fly   327 EAEEGETVLI----RCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIM 387
               ||::|.:    .||:|..|:.|   |.: .:......|:.|.:.||....||:|.|      
Zfish   134 ---EGDSVRLTCRSSCNLTDTPTFI---WYR-NSHTLTNIGDELNIRSVSRTEAGHYSC------ 185

  Fly   388 QPFSSKRVEGVGNSTVALLVRHRPGQAYITP 418
                     ||            .||.||:|
Zfish   186 ---------GV------------QGQTYISP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653 5/26 (19%)
Ig 147..228 CDD:299845 5/26 (19%)
I-set 232..313 CDD:254352 14/82 (17%)
IGc2 250..302 CDD:197706 6/51 (12%)
IG_like 323..385 CDD:214653 18/65 (28%)
IGc2 330..385 CDD:197706 17/58 (29%)
Ig_2 416..501 CDD:290606 2/3 (67%)
IG_like 418..501 CDD:214653 1/1 (100%)
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC110439988XP_021333834.1 Ig 13..102 CDD:325142 14/63 (22%)
IGc2 134..185 CDD:197706 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.