DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fred and LOC110439975

DIOPT Version :9

Sequence 1:	NP_608812.3	Gene:	fred / 33613	FlyBaseID:	FBgn0051774	Length:	1447	Species:	Drosophila melanogaster
Sequence 2:	XP_021333801.1	Gene:	LOC110439975 / 110439975	-ID:	-	Length:	170	Species:	Danio rerio

Alignment Length:	136	Identity:	37/136 - (27%)
Similarity:	66/136 - (48%)	Gaps:	6/136 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   252 LDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYP 316
            |:|..|:.| ::.:.|.:..:||.:.....|.:::...:|:|.|.|.|..|:.....:.|||.||
Zfish     8 LNCSSDSNP-IAEISWFKATKYVGSGRIFNISKISSADSGEYKCRARNEHGEKYSDPVTLDVQYP 71

  Fly   317 P--IVFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNY 379
            |  |....|.......|::|.:.|:..:|| |..:.|.|  ...|..:|.:..:.::.::.:|.|
Zfish    72 PRNISVSLSGPSVIMSGDSVTLSCSSDSNP-PAEISWFK--GETFIRSGRIFNISNISSDDSGEY 133

  Fly   380 ICRSVN 385
            .||..|
Zfish   134 KCRVRN 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fred	NP_608812.3	Ig	29..126	CDD:299845
		IG_like	141..228	CDD:214653
		Ig	147..228	CDD:299845
		I-set	232..313	CDD:254352	15/60 (25%)
		IGc2	250..302	CDD:197706	13/49 (27%)
		IG_like	323..385	CDD:214653	15/61 (25%)
		IGc2	330..385	CDD:197706	14/54 (26%)
		Ig_2	416..501	CDD:290606
		IG_like	418..501	CDD:214653
		I-set	505..612	CDD:254352
		Ig	526..611	CDD:143165
		IG_like	633..715	CDD:214653
		Ig	635..713	CDD:143165
		FN3	720..838	CDD:238020
LOC110439975	XP_021333801.1	Ig_2	3..68	CDD:316418	15/60 (25%)
LOC110439975	XP_021333801.1	Ig_2	82..153	CDD:316418	15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D35531at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010