DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC110439914

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_021333328.1 Gene:LOC110439914 / 110439914 -ID:- Length:206 Species:Danio rerio


Alignment Length:273 Identity:55/273 - (20%)
Similarity:92/273 - (33%) Gaps:94/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 ANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIIL 499
            :|||..   .:.||::      |....:..|..:|..::     |:::|.|.|..|..:...:.:
Zfish     6 SNPPAL---SFSWFKE------NQSSAVGSGQSFSAVQS-----GRFYCEAHNPHGAQRSDAVTV 56

  Fly   500 EVHQPPQFLAKLQQHMTRRVGDVDYAVTCSAKGKPTPQIRWIKDGTEILPTRKMFDIRTTPTDAG 564
            .||          :|..|.:     .:|.::.|.....|..|                       
Zfish    57 TV
H----------EHAERNI-----IITATSVGVLIIFIIII----------------------- 83

  Fly   565 GGVVAVQSILRFRGKARPNGNQLLPNDRGLY------TCLYENDVNSANSSMHLRIEHEPIVIHQ 623
              |:.|..|::.:...:..|..:..||  ||      |.:|:|.|          .:..|:....
Zfish    84 --VIIVLFIIKKQRSVKSEGLIVTQND--LYSDVPQKTQVYDNPV----------CDPGPVDEAP 134

  Fly   624 YNKVAYDLRESAEVVCR---------VQAY---PK----PEFQWQYGNNPSPLTMSSDGHYEIST 672
            |..|  :.|.|||  ||         ||.:   ||    .|.|.|..|  :|:......|.:.:.
Zfish   135 YETV--NPRISAE--CRGAEEIQYATVQYHKNTPKKKEEEEEQRQCDN--TPVQQPDQDHRQENV 193

  Fly   673 RMENNDVYTSILR 685
            ......|..|:|:
Zfish   194 ETVEESVIYSMLK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352
IGc2 250..302 CDD:197706
IG_like 323..385 CDD:214653
IGc2 330..385 CDD:197706
Ig_2 416..501 CDD:290606 13/65 (20%)
IG_like 418..501 CDD:214653 13/65 (20%)
I-set 505..612 CDD:254352 18/112 (16%)
Ig 526..611 CDD:143165 16/90 (18%)
IG_like 633..715 CDD:214653 18/69 (26%)
Ig 635..713 CDD:143165 17/67 (25%)
FN3 720..838 CDD:238020
LOC110439914XP_021333328.1 Ig_2 <2..58 CDD:316418 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.