DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC108645196

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_031762431.1 Gene:LOC108645196 / 108645196 -ID:- Length:568 Species:Xenopus tropicalis


Alignment Length:431 Identity:103/431 - (23%)
Similarity:144/431 - (33%) Gaps:83/431 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSLDTREGVDLVLKCRFTEHYDSTDFTFYWARWT--CCPTLFENVAIGDVQLNSNYRLDFRPSR- 84
            :|:....|..:.:.|.||....:..|...|.|.|  ....:|......||  :..||  .|.|| 
 Frog    35 ESIRALRGSCVEIPCTFTLPRGNKGFNLIWYRETKHSSNIIFSQQDPSDV--SEGYR--GRTSRV 95

  Fly    85 ---------GIYDLQIKNTSYNRDNGRFECRIKAKGTGADVHQEFYNLTVLTA--------PHPP 132
                     .|.|:|...|.|...:|..:...:.:.....|.....|.||:.:        ....
 Frog    96 GNEPNSCSLRINDVQESGTYYPYIHGNCDVISECQRVRVQVSDSPKNATVIISDGKKEMKEDKAK 160

  Fly   133 MVTPGNLAVATEEKPLELTCSSIGGSPDP---MITWYREGSTVPLQSYALKGGSKNHYTNATLQI 194
            .||........|...|||.|.....:|..   ..:||..|:.|            |..|...|||
 Frog   161 NVTIKGKKEVKERAALELECHFSDYNPPTTQYSYSWYLNGNPV------------NGETGRILQI 213

  Fly   195 VPRRADDGAKYKCVVWNRAMPEGHMLETSVTLNVNYYPR---VEVGPQNPLKVERDHVAKLDCRV 256
            ..........|.|.|.|||   |....|...:.|.|.|:   |.:......:.|.|.| :|.|..
 Frog   214 NNITESHSGTYSCNVQNRA---GRSNSTGFAVTVMYSPKNVTVVISDGKKERKEDDKV-RLSCLS 274

  Fly   257 DAKPMVSNVRW----------SRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKDIVL 311
            ||.|...|..|          .|..|..:.|.|....|      .:::|.|.|..|....|.:.|
 Frog   275 DANPAADNFIWYKHVRNEPKKRRPEQRQNITVTVGWDR------DRFSCIARNPRGPGKSKILEL 333

  Fly   312 DVLYPPIVFIESKTHEAEEGETVLIRCNVT-ANP--SPINVEWLKEGAPDFRYTGELLTLGSVRA 373
            .|||........:..|.:||..:.:.|:.: .||  :..:..|...|.|....||.:|.:.::..
 Frog   334 QVLYKAKNVTIKRKDEVKEGAALELECHFSDYNPPTTQYSYSWYLNGNPVNGETGRILQINNITE 398

  Fly   374 EHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQA 414
            .|:|.|.|...|           |.|.|       :.||.|
 Frog   399 SHSGTYSCNVQN-----------GAGPS-------YSPGFA 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 25/108 (23%)
IG_like 141..228 CDD:214653 23/89 (26%)
Ig 147..228 CDD:299845 22/83 (27%)
I-set 232..313 CDD:254352 23/93 (25%)
IGc2 250..302 CDD:197706 15/61 (25%)
IG_like 323..385 CDD:214653 16/64 (25%)
IGc2 330..385 CDD:197706 15/57 (26%)
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC108645196XP_031762431.1 Ig 29..>116 CDD:416386 21/84 (25%)
FR1 29..53 CDD:409353 4/17 (24%)
Ig strand A 29..33 CDD:409353
Ig strand A' 36..40 CDD:409353 1/3 (33%)
Ig strand B 42..53 CDD:409353 3/10 (30%)
CDR1 54..59 CDD:409353 0/4 (0%)
FR2 60..67 CDD:409353 2/6 (33%)
Ig strand C 60..67 CDD:409353 2/6 (33%)
CDR2 68..89 CDD:409353 4/22 (18%)
Ig strand C' 75..79 CDD:409353 1/3 (33%)
Ig strand D 91..95 CDD:409353 2/3 (67%)
Ig strand E 100..108 CDD:409353 1/7 (14%)
Ig 176..244 CDD:416386 22/82 (27%)
Ig strand B 176..183 CDD:409353 4/6 (67%)
Ig strand C 189..198 CDD:409353 1/8 (13%)
Ig strand C' 201..208 CDD:409353 2/18 (11%)
Ig strand E 211..217 CDD:409353 3/5 (60%)
Ig strand F 220..231 CDD:409353 3/10 (30%)
Ig strand G 233..244 CDD:409353 2/10 (20%)
Ig_2 266..332 CDD:404734 19/72 (26%)
IG 349..418 CDD:214652 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.