DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC108183407

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_021330937.1 Gene:LOC108183407 / 108183407 -ID:- Length:495 Species:Danio rerio


Alignment Length:444 Identity:89/444 - (20%)
Similarity:138/444 - (31%) Gaps:175/444 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ISGDDSLDTREGVDLVLKCRF--TEHYD---STDFTFYWARWTCCPTLFENVAIGDVQLNSNYRL 78
            ||..:.:....|..:|:||||  .:.||   :.....||         |::      ..|.:..|
Zfish    30 ISLPEKIQALSGSCVVIKCRFDINDTYDKNLTERAAGYW---------FKS------GTNVDKNL 79

  Fly    79 DFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKGTGADVHQEFYNLTVLTAPHPPMVTPGNLAVAT 143
            .|..|..:.:|.||.            :|..|.|..|....||.:|        .:..|......
Zfish    80 IFNSSESMQNLFIKG------------KITGKLTDKDCTTVFYEVT--------SIHSGQYMFRI 124

  Fly   144 EEKPLELTCSSIGGSPDPMITWYREGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCV 208
            |.                                  :||.|..|.                    
Zfish   125 EG----------------------------------EGGLKWTYN-------------------- 135

  Fly   209 VWNRAMPEGHMLETSVTLNVNYYPRVEVGPQNP---LKVERDHV---------AKLDCRVDAKPM 261
                        :|:|:|:|     :| .|.||   |.|::..:         ..:..|..|:.:
Zfish   136 ------------KTNVSLDV-----IE-SPMNPRVVLYVDKQELQGQQEVLEGRSVSLRCSAETL 182

  Fly   262 VSN----VRWSRNGQYVSATPTHTIYRVN---------RHHAGKYTCS-----ADNGLGKTGEKD 308
            .|:    :.||...:.:.:..:.....:|         |||...:|||     .||  .:|....
Zfish   183 CSSPPATLTWSSTARILLSESSKLQELINSDLNFTAARRHHRVTFTCSISYQLQDN--NRTAHSS 245

  Fly   309 IVLDVLYPPIVFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEG-----APDFRYTGELLTL 368
            |.|.|.|.|.:...|    ...|...:..|.|..||||: |||...|     :.:...:.|.|:.
Zfish   246 ITLHVQYAPQILNSS----CNIGNVTVCFCEVDGNPSPV-VEWHLSGRLILNSSNTFISEERLSN 305

  Fly   369 GSVRA--------EHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQA 414
            .|:|:        .|....:|.|.|.:           ||:  :.|.:|.|..|
Zfish   306 TSLRSVISLHQSLTHTNTLLCVSKNTL-----------GNA--SHLFQHLPSTA 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 25/101 (25%)
IG_like 141..228 CDD:214653 8/86 (9%)
Ig 147..228 CDD:299845 7/80 (9%)
I-set 232..313 CDD:254352 23/110 (21%)
IGc2 250..302 CDD:197706 14/69 (20%)
IG_like 323..385 CDD:214653 19/74 (26%)
IGc2 330..385 CDD:197706 18/67 (27%)
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC108183407XP_021330937.1 Ig 28..142 CDD:325142 35/212 (17%)
Ig_3 165..232 CDD:316449 12/66 (18%)
Ig 250..335 CDD:325142 24/100 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.