DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC105945909

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_031762429.1 Gene:LOC105945909 / 105945909 -ID:- Length:275 Species:Xenopus tropicalis


Alignment Length:192 Identity:54/192 - (28%)
Similarity:76/192 - (39%) Gaps:50/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 VFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELL---------TLGSVRAE 374
            |.|.:...|..||:.|.:.|...|||:..|..|......    |.|||         |:|..|. 
 Frog    40 VVISNGRKEFIEGDNVTLSCVCDANPAANNFTWYNNRDK----TLELLEEQGRSITVTVGRGRE- 99

  Fly   375 HAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQAYITPNKPVVHVGNG------VTL-- 431
               .:.|.:.|.:         |:|||....|      |....|....|.:.:|      |||  
 Frog   100 ---TFSCAAGNPL---------GIGNSNALEL------QVLYPPKNVTVSILDGNLDLTNVTLIC 146

  Fly   432 TCSANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGK-YHCHAVNELGIG 492
            ||.|.|   .|..|.|:||..|.:...::   |..:.:|   ::|.|.: |.|.|.|:||:|
 Frog   147 TCFARP---AVKNYTWYRDRQGQVTTFEE---QSAEITI---NIGPEKELYFCSATNQLGVG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352
IGc2 250..302 CDD:197706
IG_like 323..385 CDD:214653 18/70 (26%)
IGc2 330..385 CDD:197706 17/63 (27%)
Ig_2 416..501 CDD:290606 27/86 (31%)
IG_like 418..501 CDD:214653 27/84 (32%)
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC105945909XP_031762429.1 IG 51..121 CDD:214652 23/92 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.