DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC103910452

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_017210804.1 Gene:LOC103910452 / 103910452 -ID:- Length:410 Species:Danio rerio


Alignment Length:403 Identity:80/403 - (19%)
Similarity:130/403 - (32%) Gaps:140/403 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ISGDDSLDTREGVDLVLKCRF--TEHYDSTDFTFYWARWTCCPTLFENVAIGDVQLNSNYRLDFR 81
            ||..:.:....|..:::||||  .|.||..               ....|.|....:.:.|:   
Zfish    24 ISLPEKIQALNGSCVIIKCRFDINETYDKD---------------ISERAAGVWYKDKHDRI--- 70

  Fly    82 PSRGIYDLQIKNTSYNRDNGRFECRIKAKGTG----ADVHQEFYNLTVLTAPHPPM--------- 133
             |..:::..::|:.           ||.|.||    .|.:..||:   :|:.|...         
Zfish    71 -SSPVFNSSMQNSF-----------IKGKITGKLKDKDCNTVFYD---VTSNHSGQYFFRIEGEG 120

  Fly   134 -----VTPGNLAVATEEKPLELTCSSIGGSPDPMITWYREGSTVPLQSYALKGGSKNHYTNATLQ 193
                 ...||::|...|.|:           :|.:..|.:|..:..|...|:|.|          
Zfish   121 GLKWTYRKGNVSVNVIESPV-----------NPRVVLYVDGQELQGQQEVLEGRS---------- 164

  Fly   194 IVPRRADDGAKYKCVVWNRAMPEGHMLETSVTLNVNYYPRVEVGPQNPLKVERDHVAKLDCRVDA 258
                           |..|...|........||..:...::.:...:.||               
Zfish   165 ---------------VSLRCSAETLCSSPPATLTWSSTAKIPLSKSSKLK--------------- 199

  Fly   259 KPMVSNVRWSRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGL---GKTGEKDIVLDVLYPPIVF 320
            :.::|::.:       :|.|        |||...:|||....|   .:|....|.|.|.|...: 
Zfish   200 ELIISDLNF-------TAAP--------RHHRVTFTCSISYQLQNKNRTAHSSITLHVQYATQI- 248

  Fly   321 IESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTG-----ELLTLGSVRA------- 373
              |.:..:....||.. |.|..||.|: |||...|.|....:.     |.|:..|:|:       
Zfish   249 --SNSSCSSTNVTVCF-CEVDGNPYPV-VEWYLSGRPVSNSSSTFISKERLSNTSLRSFISLHQS 309

  Fly   374 -EHAGNYICRSVN 385
             .|:...:|.|.|
Zfish   310 LTHSNTLLCVSKN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 21/102 (21%)
IG_like 141..228 CDD:214653 15/86 (17%)
Ig 147..228 CDD:299845 13/80 (16%)
I-set 232..313 CDD:254352 15/83 (18%)
IGc2 250..302 CDD:197706 10/54 (19%)
IG_like 323..385 CDD:214653 20/74 (27%)
IGc2 330..385 CDD:197706 19/67 (28%)
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC103910452XP_017210804.1 Ig 22..135 CDD:299845 28/143 (20%)
Ig 152..232 CDD:299845 21/134 (16%)
IG_like 154..242 CDD:214653 24/142 (17%)
Ig 259..334 CDD:299845 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.