DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC103909419

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_009293431.2 Gene:LOC103909419 / 103909419 -ID:- Length:517 Species:Danio rerio


Alignment Length:484 Identity:104/484 - (21%)
Similarity:161/484 - (33%) Gaps:140/484 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GRFECRIKAKGTG---------ADVHQEFYNLTVLTAPHPPMVTPG------NLAVATEEKPLE- 149
            ||.:|....|.|.         ||.|..:...|...........||      :|.|.|::..:| 
Zfish    83 GRVQCVRADKDTSSITLTAVTEADKHIYYCRFTTDVEGGKWTGIPGVQLDVT
DLQVETQQTVVEG 147

  Fly   150 ----LTCSSIGGSP-DPMITWYREGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCVV 209
                |:|.|....| :....|.|...|:          ::...|...||:...|..|...|:|.|
Zfish   148 DSVTLSCKSSCSLPEETTFIWSRNTKTI----------NEGIRTKNQLQLWSVRGSDAGYYQCAV 202

  Fly   210 WNRAMPEGHMLETSVTL-----------NVNYYPRVEVGPQNPLKVERDHVAKLDC--------- 254
            ....    |::..:|.:           .|||.|       :.:...:....|:.|         
Zfish   203 GGNE----HLISPAVYVKVGRVYGLWKSGVNYSP-------SYVCALKGSTVKISCTSTYSVYGY 256

  Fly   255 ----RVDAKPMVSN------------------VRWSRNGQYVSATPTHTIYRVNRHHAGKYTC-- 295
                .|..||.|:.                  |...:|...::.|   .:...::|   .|.|  
Zfish   257 QLIQSVSTKPAVTGEEPPDLCTDTDIRGGIQCVSEDKNTLIITLT---AVTEADKH---IYYCRF 315

  Fly   296 -SADNGLGKT--GEKDIVLDVLYPPIVFIESKTHEAEEGETVLIRCNVTAN-PSPINVEWLKEGA 356
             ...|.....  |.:..|.|:.      :|:| ...:||::|.:.|..:.: |......|.:...
Zfish   316 RDTQNNRWTVIPGARLDVTDLQ------VETK-QCVKEGDSVTLSCKSSCSLPEETTFIWYRNTE 373

  Fly   357 PDFRYTGELLT----LGSVRAEHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQAYIT 417
               |.|||.|.    |.||....||.|.|.:       ..|..|.:.:..|.|.|.:.|....::
Zfish   374 ---RLTGETLNNQLQLQSVSHSDAGEYRCAA-------RGKAGERLNSPPVYLSVEYPPKSVSVS 428

  Fly   418 PNKPVVHV-GNGVTLTCS--ANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEG 479
            .:...|.| |:.|||:||  :|||..   .:...:| :..:|:       |..:||........|
Zfish   429 VSGSAVIVSGDSVTLSCSSNSNPPAL---NFSRLKD-ETSVGS-------GRIFSISNISSDHSG 482

  Fly   480 KYHCHAVNELGIGKIATIILEVHQPPQFL 508
            :|.|.|.|:.|         |.|..|..|
Zfish   483 EYKCRARNKHG---------EKHSDPVML 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 9/33 (27%)
IG_like 141..228 CDD:214653 20/103 (19%)
Ig 147..228 CDD:299845 18/97 (19%)
I-set 232..313 CDD:254352 16/116 (14%)
IGc2 250..302 CDD:197706 13/85 (15%)
IG_like 323..385 CDD:214653 19/66 (29%)
IGc2 330..385 CDD:197706 18/59 (31%)
Ig_2 416..501 CDD:290606 22/87 (25%)
IG_like 418..501 CDD:214653 22/85 (26%)
I-set 505..612 CDD:254352 2/4 (50%)
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC103909419XP_009293431.2 Ig 30..134 CDD:325142 11/50 (22%)
ig 137..202 CDD:278476 17/74 (23%)
IG_like 344..407 CDD:214653 19/72 (26%)
Ig_2 438..504 CDD:316418 24/85 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.