DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC101884775

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_009298710.1 Gene:LOC101884775 / 101884775 -ID:- Length:509 Species:Danio rerio


Alignment Length:427 Identity:89/427 - (20%)
Similarity:135/427 - (31%) Gaps:155/427 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ISGDDSLDTREGVDLVLKCRFTEHYDSTDFTFYWARWTCCPTLFENVAIGDVQLNSNYRLDF-RP 82
            ||..:.:....|..:|:||||                               ::|..|..|. ..
Zfish    24 ISLPEKIQALSGSCVVIKCRF-------------------------------EINETYDKDLTER 57

  Fly    83 SRGIY--DLQIKNTS--YNRDNGRFECRIKAKGTG----ADVHQEFYNLTVLTAPHPPMVTPGNL 139
            :.|::  |...|::|  :|.........||...||    .|....||::|               
Zfish    58 AAGVWYKDTHDKSSSPVFNSSASTQNSFIKGNITGQLNYKDCTTVFYDVT--------------- 107

  Fly   140 AVATEEKPLELTCSSIGGSPDPMITWYR-EGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGA 203
                         |:..|.     .::| ||          :||.|..:|.:...:|        
Zfish   108 -------------SNHSGQ-----YFFRIEG----------EGGLKWTFTKSNTSVV-------- 136

  Fly   204 KYKCVVWNRAMPEGHMLETSVTLNVNYYPRVEVGPQNPLKVERDHVAKLDCRVD---AKPMVSNV 265
                |:.:...|:       |.|.||     |...|:..:|.......|.|..|   :.| .:.:
Zfish   137 ----VIESPVNPQ-------VVLYVN-----EQELQDQQEVLEGRSVSLRCSADDLCSSP-PATL 184

  Fly   266 RWSRNGQYVSATPTH---------TIYRVNRHHAGKYTCS-----ADNGLGKTGEKDIVLDVLYP 316
            .||...:...:..:.         ......|||...:|||     .||  .||....|.|.|.|.
Zfish   185 TWSSTARIPHSESSKLQELIISDLNFTAAQRHHRVTFTCSISYQLQDN--NKTAHSSITLHVQYA 247

  Fly   317 PIVFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGS---VRAEHAGN 378
            |.:...|    ...|...:..|.|..||||: |||        ..:|.|::..|   :..|...|
Zfish   248 PQILNSS----CNIGNVNVCFCEVDGNPSPV-VEW--------HLSGRLVSNSSNMFISEERLSN 299

  Fly   379 YICRS-VNIMQPFS--------SKRVEGVGNSTVALL 406
            ...|| :::.|..:        ||...  ||.::.||
Zfish   300 TSLRSFISLDQSLTQTSTLLCVSKNTH--GNESLQLL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 22/105 (21%)
IG_like 141..228 CDD:214653 14/87 (16%)
Ig 147..228 CDD:299845 14/81 (17%)
I-set 232..313 CDD:254352 21/97 (22%)
IGc2 250..302 CDD:197706 14/68 (21%)
IG_like 323..385 CDD:214653 18/65 (28%)
IGc2 330..385 CDD:197706 17/58 (29%)
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC101884775XP_009298710.1 Ig 22..137 CDD:299845 34/198 (17%)
Ig 154..230 CDD:299845 14/76 (18%)
IG_like 158..244 CDD:214653 19/88 (22%)
DUF499 276..>493 CDD:303008 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.