DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC101884649

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_009298713.1 Gene:LOC101884649 / 101884649 -ID:- Length:490 Species:Danio rerio


Alignment Length:630 Identity:115/630 - (18%)
Similarity:197/630 - (31%) Gaps:227/630 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LQSYALKG----------GSKNHYTNATLQIVPRRADDGAKYKCVVWNRA----MPEGHMLETSV 224
            |.|:.|||          ..|....|.:..||..|.|....|...:..||    ..:.|...:||
Zfish    11 LLSFLLKGVCCRDFNVSLPEKIQALNGSCVIVKCRFDIKESYDKDLTERAAGVWYKDKHDTSSSV 75

  Fly   225 TLNVNYYPRVEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNRHH 289
            ..|.:      ...||.. ::.:...||..: |...:..::|...:|||        .:|:....
Zfish    76 VFNSS------ASMQNSF-IKGNITGKLKDK-DCTTVFYDIRSIHSGQY--------FFRIEGEG 124

  Fly   290 AGKYTCSADNGLGKTGEKDIVLDVL-YPPIVFIESK-----THEAEEGETVLIRCN--VTANPSP 346
            ..|:|.:      |:....:|::.| .|.::..|.|     ..|..||.:|.:||:  ...:.||
Zfish   125 GLKWTFT------KSNTSVVVIETLENPRVLLYEDKQELHNQQEVLEGRSVSLRCSAETLCSSSP 183

  Fly   347 INVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKRVEG--VGNSTVALLVRH 409
            ..:.|                ..:.|..|:              .|.:::.  |.:.......||
Zfish   184 ATLTW----------------SSTARIPHS--------------ESSKLQDLIVSDLNFTAAPRH 218

  Fly   410 RPGQAYITPNKPVVHVGNGVTLTCSANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAH 474
                             |.||..||.:           ::..|.:                ..||
Zfish   219 -----------------NRVTFICSIS-----------YQLQDNN----------------KTAH 239

  Fly   475 LGSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVT---CSAKGKPTP 536
                                ::|.|.|...|:.......:.|.        ||   |...|.|:|
Zfish   240 --------------------SSITLHVQYAPRISNSSSCNSTN--------VTVCFCEVDGNPSP 276

  Fly   537 QIRWIKDGTEILPTRKMF--DIRTTPTDAGGGVVAVQS------ILRFRGKARPNGNQLL----- 588
            .:.|...|..:..:...|  :.|.:.|.....:...||      :|.|....|.|..|:|     
Zfish   277 VVEWHLSGRPVSNSSNTFISEERLSNTSLRSFISLHQSLTHTNTLLCFSKNTRGNATQILQLTPF 341

  Fly   589 PNDRGLYTCLYENDVNSANSSMHLRIEHEPIVIHQYNKVAYDLRESAEVVCRVQAYPKPEFQWQY 653
            ..|||:::......|....|.:.:.|            :.|.:|:..   ||.       .|.:.
Zfish   342 SQDRGVHSFSVLIGVAVGVSLIMMCI------------IIYCVRKER---CRC-------LQTKQ 384

  Fly   654 GNNPSPLTMSSDGHYEISTRMENNDVYTSILRIAHLQHSDYGEYI-----CRAVNPLDSIR---- 709
            .:....:|  :||    :.::||.              ::|..||     ...::|.:|:.    
Zfish   385 EDTTGVIT--TDG----AVQLENK--------------TEYANYIILPPELTTIHPQESLHYASV 429

  Fly   710 --APIRLQPKGSPEKPTNLKILEVGHNYAVLNWTPGFNGGFMSTK 752
              ..|:.:.|...||.:      :..:|||:|    ::||...|:
Zfish   430 EFKNIKQESKEMKEKSS------LTTDYAVIN----YSGGVTETE 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653 17/67 (25%)
Ig 147..228 CDD:299845 17/67 (25%)
I-set 232..313 CDD:254352 14/80 (18%)
IGc2 250..302 CDD:197706 10/51 (20%)
IG_like 323..385 CDD:214653 12/68 (18%)
IGc2 330..385 CDD:197706 10/56 (18%)
Ig_2 416..501 CDD:290606 10/84 (12%)
IG_like 418..501 CDD:214653 10/82 (12%)
I-set 505..612 CDD:254352 26/122 (21%)
Ig 526..611 CDD:143165 24/100 (24%)
IG_like 633..715 CDD:214653 14/92 (15%)
Ig 635..713 CDD:143165 13/88 (15%)
FN3 720..838 CDD:238020 9/33 (27%)
LOC101884649XP_009298713.1 Ig 24..139 CDD:299845 26/136 (19%)
Ig <264..343 CDD:299845 18/78 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.