DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC101883960

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_021333851.1 Gene:LOC101883960 / 101883960 -ID:- Length:470 Species:Danio rerio


Alignment Length:394 Identity:85/394 - (21%)
Similarity:155/394 - (39%) Gaps:83/394 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 CSSIGGSPDPMITWYREGSTVPLQSYALKG--------------------------GSKNHYTNA 190
            |..:..:|.|.|...| ||||....:...|                          .|.|...:.
Zfish    24 CWYVNYTPSPYICALR-GSTVSTTCFYPTGYQIEEVFWTTSKNAKLSGPEISQWDCSSGNQENSY 87

  Fly   191 TLQIVPRRADDGAKYKCVV---WNRAMPEGHMLETSVTLNVNYYPRVEVGPQNPLKVERDHVAKL 252
            .|.|.....:|...|.|..   |:........:..|||         ::..::|.:|......:|
Zfish    88 CLHISEVTQEDSDNYYCTFVSSWDNIFSATQGVRLSVT---------DLQVESPERVTEGDSVRL 143

  Fly   253 DCRVDAKPMVSNV-RWSRNGQYVS--ATPTHTIY-RVNRHHAGKYTCSADNGLGKTGE----KDI 309
            .||...|.:.:.: .|.||.:.::  :.....:| .|:|.|||.|:|      |..|:    ..:
Zfish   144 TCRSSCKLIDTPIFIWYRNSKPLTQGSIQNKLVYSSVSRGHAGGYSC------GVQGQDYISPTV 202

  Fly   310 VLDVLYPP--IVFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVR 372
            .|:|.|.|  ::...|::....||::|.:.|:..:|| |..:.|.|  ..::..:|.:.::..::
Zfish   203 YLNVRYKPWSVLVSISESDVITEGDSVTLSCSSDSNP-PAALLWYK--GVEYIKSGRIFSILMIK 264

  Fly   373 AEHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQAYIT-PNKPVVHVGNGVTLTC--S 434
            ::.:|.|.||::|   ....|.     :..|.|.|::.|....:: ....|:..|:.|:|.|  .
Zfish   265 SDDSGEYKCRAIN---EHGEKY-----SDPVTLDVQYPPRSVSVSISGSAVIMSGDSVSLMCISD 321

  Fly   435 ANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIIL 499
            :|||..   .:.||.:      |....:..|..:|..::     |:::|.|.|..|..:...:.:
Zfish   322 SNPPAL---SFSWFEE------NQSSAVGSGQSFSAVQS-----GRFYCEAHNPHGAQRSDAVTV 372

  Fly   500 EVHQ 503
            .|.|
Zfish   373 TVQQ 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653 21/104 (20%)
Ig 147..228 CDD:299845 21/104 (20%)
I-set 232..313 CDD:254352 20/88 (23%)
IGc2 250..302 CDD:197706 15/55 (27%)
IG_like 323..385 CDD:214653 15/61 (25%)
IGc2 330..385 CDD:197706 14/54 (26%)
Ig_2 416..501 CDD:290606 18/87 (21%)
IG_like 418..501 CDD:214653 18/84 (21%)
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC101883960XP_021333851.1 IG 37..124 CDD:214652 14/87 (16%)
Ig_3 131..190 CDD:316449 16/58 (28%)
Ig_2 214..291 CDD:316418 19/87 (22%)
Ig_2 305..374 CDD:316418 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.