DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC101735075

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_031747070.1 Gene:LOC101735075 / 101735075 XenbaseID:XB-GENE-29088267 Length:312 Species:Xenopus tropicalis


Alignment Length:350 Identity:75/350 - (21%)
Similarity:107/350 - (30%) Gaps:127/350 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 VRHRPGQAYITPNKPVVHVGNGVTLTCSANPPGWPVPQ-YRWFRDMDGDIGNTQKILAQGPQYSI 470
            |..||..:: :||...:.....:||||:..|.. |:.| |.|:||       .:.|..:...:.|
 Frog     7 VAMRPVVSF-SPNWATISRHETITLTCTVGPTA-PLSQRYSWYRD-------NETINGEERSFII 62

  Fly   471 PKAHLGSEGKYHCHA-------------VNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDV 522
            .||.....|.|.|.|             .|:       .:||:.  ||....          || 
 Frog    63 GKAEEKDSGNYQCQAGTSERSDPVRLNVTND-------RVILQA--PPSVYE----------GD- 107

  Fly   523 DYAVTCSAKGKPTPQIRWIKDGTEILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPNGNQL 587
            ...:.|.........:.:.||..         .|.::.||.          |...|....||.  
 Frog   108 PLTLRCYNPYTKAQNVTFYKDNV---------TISSSLTDT----------LTLVGSMAMNGT-- 151

  Fly   588 LPNDRGLYTCLYENDVNSANSSMHLRIEHEPIVIHQYNKVAYDLRESAEVVCRVQ-AYPKPEFQ- 650
                   |||                     |...|.:.:.|....|||:|..:| .:|:||.: 
 Frog   152 -------YTC---------------------IKYLQRHAIRYSPYTSAEIVITIQELFPRPEIRA 188

  Fly   651 ----WQYGN----------NPS------PLTMSSDGHYEISTRMENNDVYTSILRIAHLQHSDYG 695
                .|.|:          ||:      ......:||........:|  ||    |...:..|.|
 Frog   189 ANDSVQEGDVLTLSCHTALNPARGATQLQFAFYRNGHNVQGFSSSSN--YT----IQSARPQDSG 247

  Fly   696 EYICRAVNPLDSIRAPIRLQPKGSP 720
            .|.|....|..|:       .||||
 Frog   248 NYTCDTAAPSVSV-------TKGSP 265

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250
Ig strand B 148..152 CDD:409353
Ig strand C 162..166 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 238..313 CDD:472250
Ig strand B 250..254 CDD:409353
Ig strand C 264..268 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Ig strand G 306..309 CDD:409353
Ig_3 316..385 CDD:464046
Ig_2 416..501 CDD:464026 24/98 (24%)
Ig 523..614 CDD:472250 13/90 (14%)
Ig strand B 524..528 CDD:409568 0/3 (0%)
Ig strand C 537..541 CDD:409568 0/3 (0%)
Ig strand E 566..570 CDD:409568 0/3 (0%)
Ig strand F 594..599 CDD:409568 3/4 (75%)
Ig strand G 607..610 CDD:409568 0/2 (0%)
Ig_3 618..703 CDD:464046 25/106 (24%)