DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC101731766

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_031762300.1 Gene:LOC101731766 / 101731766 -ID:- Length:508 Species:Xenopus tropicalis


Alignment Length:448 Identity:105/448 - (23%)
Similarity:166/448 - (37%) Gaps:125/448 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLDTREGVDLVLKCRFTEHYDSTDFTFYW------------ARW--------------------- 55
            |:....|..:|:.|.||....:.||:..|            ::|                     
 Frog    36 SIRALRGSCVVIPCTFTLPRGNKDFSLDWYKEKFLFDKIIFSQWDPSDVSEGYRGRTSLVGNEPN 100

  Fly    56 TCCPTLFENVAIGDVQLNSNYRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKGTGADVHQEF 120
            :|      ::.|.|||.|..|   :....|..|:.:        ...::|. |.:.|.:||..| 
 Frog   101 SC------SLRINDVQENGTY---YPYIHGNCDVSL--------TANYQCH-KVQVTVSDVPNE- 146

  Fly   121 YNLTVLTAPHPPMVTPGNLAVATEEKPLELTCS---SIGGSPDPMITWYREGSTVPLQSYALKGG 182
                      |.:..|.:|   ||.:...::||   :...|| |.:.|.|.|..:..:..:||.|
 Frog   147 ----------PAIQIPTDL---TEGERTPISCSVEHTCPPSP-PTLQWNRAGYKLTDRQQSLKDG 197

  Fly   183 SKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGHMLETSVTLNVNYYPR---VEVGPQNPLKV 244
            .....|  .::.:|...|.||:.:|   ....|.|...:..||||:.|.|:   |.:......:.
 Frog   198 VWKAET--VMEYLPSYRDHGAELEC---EATYPNGLRSQRRVTLNITYSPKNVSVVISDGKKERK 257

  Fly   245 ERDHVAKLDCRVDAKPMVSNVRWSRN------------GQYVSATPTHTIYRVNRHHAGK--YTC 295
            |.|.|: |.|..||.|..:...|..|            |:.::.|       |.|   |:  ::|
 Frog   258 EGDAVS-LTCASDANPAANAFTWYNNKRDGTVELREEQGRSITVT-------VGR---GRETFSC 311

  Fly   296 SADNGLGKTGEKDI-VLDVLYPPIVFIESKTHEAEEGETVLIRCNVT-ANP--SPINVEWLKEGA 356
            :|.|.|| ||...: .|.|||........:..|.:||..:.:.|:.: .||  :..:..|...|.
 Frog   312 TARNPLG-TGNSTLSELQVLYKAKNVTIKRKDEVKEGAALELECHFSDYNPPTTQYSYSWYLNGN 375

  Fly   357 PDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQA 414
            |....||.:|.:.::...|:|.|.|...|           |.|.|       :.||.|
 Frog   376 PVNGETGRILQINNITESHSGTYSCNVQN-----------GAGPS-------YSPGFA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 24/129 (19%)
IG_like 141..228 CDD:214653 24/89 (27%)
Ig 147..228 CDD:299845 22/83 (27%)
I-set 232..313 CDD:254352 25/98 (26%)
IGc2 250..302 CDD:197706 15/65 (23%)
IG_like 323..385 CDD:214653 16/64 (25%)
IGc2 330..385 CDD:197706 15/57 (26%)
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC101731766XP_031762300.1 Ig 29..>116 CDD:416386 17/88 (19%)
FR1 29..53 CDD:409353 5/16 (31%)
Ig strand A 29..33 CDD:409353
Ig strand A' 36..40 CDD:409353 1/3 (33%)
Ig strand B 42..53 CDD:409353 4/10 (40%)
CDR1 54..59 CDD:409353 0/4 (0%)
FR2 60..67 CDD:409353 2/6 (33%)
Ig strand C 60..67 CDD:409353 2/6 (33%)
CDR2 73..89 CDD:409353 1/15 (7%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
Ig strand D 91..95 CDD:409353 0/3 (0%)
Ig strand E 100..108 CDD:409353 2/13 (15%)
Ig 147..237 CDD:416386 26/98 (27%)
Ig strand A 147..151 CDD:409353 1/3 (33%)
Ig strand B 160..166 CDD:409353 0/5 (0%)
Ig strand C 177..184 CDD:409353 2/6 (33%)
Ig strand E 203..209 CDD:409353 1/7 (14%)
Ig strand F 216..223 CDD:409353 2/9 (22%)
Ig strand G 229..237 CDD:409353 2/7 (29%)
Ig_2 258..322 CDD:404734 22/75 (29%)
IG 343..412 CDD:214652 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.