DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and iglon5

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:410 Identity:87/410 - (21%)
Similarity:129/410 - (31%) Gaps:159/410 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 VGPQNPLKVERDHVAKLDCRVDAKPM------VSNV------RWSRNGQYVSATPTHTIYRVNRH 288
            |.|.:...|.:...|.|.|.:|.|..      .||:      :||.:.:....|.|.:.|.:...
 Frog    30 VPPADNYTVSQGDNATLSCLIDDKVTRVAWLNRSNILYAGKDKWSIDSRVQLLTNTKSEYSIVIT 94

  Fly   289 HA-----GKYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTHEAEEGETVLIRCNVTANPSPIN 348
            |.     |.||||.... .|.....:.|.|..|..:...|.:....||..|.::|.....|.| .
 Frog    95 HVDVADEGLYTCSFQTE-DKPHTSQVYLIVQVPAKIVNISSSVTVNEGSNVNLQCLAVGKPEP-T 157

  Fly   349 VEW--LKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRP 411
            :.|  |.||   |...||||.:..:..:.||:|.|.:.|.:....:|:|:        :.|.:.|
 Frog   158 ITWQQLSEG---FSSEGELLEITEINRQQAGDYECVTSNGVSVPDTKKVQ--------ITVNYPP 211

  Fly   412 GQAYITPNKPVVHVGNGVTLTCSANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLG 476
               |||                                    |:.|     ||.|          
 Frog   212 ---YIT------------------------------------DVKN-----AQSP---------- 222

  Fly   477 SEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVTCSAKGKPTPQIRWI 541
                          :|:.||:                             .|.|...|..:..|.
 Frog   223 --------------VGRPATL-----------------------------RCKAMAVPPAEFEWY 244

  Fly   542 KD-------GTEILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPNGNQLLPNDRGLYTCLY 599
            ||       |||.|..:         |::...|:...::     .:|..||         ||||.
 Frog   245 KDEKRRLISGTEGLSIK---------TESSWSVIVFSNV-----TSRHYGN---------YTCLA 286

  Fly   600 ENDVNSANSSMHLRIEHEPI 619
            .|.:.|.|||:.|....:|:
 Frog   287 SNKLGSFNSSLRLLKPGDPL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250
Ig strand B 148..152 CDD:409353
Ig strand C 162..166 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 238..313 CDD:472250 22/91 (24%)
Ig strand B 250..254 CDD:409353 2/3 (67%)
Ig strand C 264..268 CDD:409353 1/9 (11%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Ig_3 316..385 CDD:464046 21/70 (30%)
Ig_2 416..501 CDD:464026 10/84 (12%)
Ig 523..614 CDD:472250 25/97 (26%)
Ig strand B 524..528 CDD:409568 0/3 (0%)
Ig strand C 537..541 CDD:409568 0/3 (0%)
Ig strand E 566..570 CDD:409568 1/3 (33%)
Ig strand F 594..599 CDD:409568 3/4 (75%)
Ig strand G 607..610 CDD:409568 2/2 (100%)
Ig_3 618..703 CDD:464046 1/2 (50%)
FN3 720..838 CDD:238020
iglon5XP_002938252.1 Ig 31..123 CDD:472250 22/92 (24%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 89..93 CDD:409353 1/3 (33%)
Ig strand F 103..108 CDD:409353 3/4 (75%)
Ig strand G 116..119 CDD:409353 0/2 (0%)
Ig 122..207 CDD:472250 25/96 (26%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 157..160 CDD:409353 0/2 (0%)
Ig strand E 172..176 CDD:409353 3/3 (100%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
Ig strand G 200..203 CDD:409353 1/2 (50%)
Ig_3 210..288 CDD:464046 31/197 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.