DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC100151328

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_017211407.2 Gene:LOC100151328 / 100151328 -ID:- Length:594 Species:Danio rerio


Alignment Length:653 Identity:144/653 - (22%)
Similarity:232/653 - (35%) Gaps:166/653 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLLIIGQL----WLSIGLISGDDSLDTREGVDLVLKCRFTEHYDSTDFTFYWARWTCCPTLFEN 64
            |.||||.::    |   |:......:...:...:.:.|.||  |.:..:......|.  ..|.:|
Zfish    14 IFLLIIHRVSAAGW---GVNYSPSQICALQNSSVTISCTFT--YPTPGYQIMKVFWN--KDLVKN 71

  Fly    65 VA-----------------IGDVQLNSNYRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKGT 112
            ..                 :||.:.|...||..         ..||     |...:..||....|
Zfish    72 GGEFADLSEDPEYSQRLQYLGDKKQNCTIRLSH---------VTKN-----DEHEYYFRITTNVT 122

  Fly   113 GA------DVHQEFYNLTVLTAPHPPMVTPGN-----------------LAVATEEKPLELTCSS 154
            |.      .||   .|:|.|....|..||.|:                 .||..:...:.|.|||
Zfish   123 GGRIIGIPGVH---LNVTDLQLESPERVTEGDSVRLTYPPKNVSVSINVSAVVVKGDSVSLICSS 184

  Fly   155 IGGSPDPMITWYREGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGHM 219
            ....|....:|::..::|         ||...:..:.:.     :||..:|||...|..   |..
Zfish   185 DSNPPALNFSWFKGETSV---------GSGRIFNISKIS-----SDDSGEYKCRARNYL---GEK 232

  Fly   220 LETSVTLNV-----------NYYPRVEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNGQY 273
            ....|||:|           :.||                  ..|...|:.|...|..|.:....
Zfish   233 YSAPVTLDVQCEFMNILQGMSQYP------------------SEDLLSDSNPPALNFSWFKGDTS 279

  Fly   274 VSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPP--IVFIESKTHEAEEGETVLI 336
            |.:.....|.:::...:|:|.|.|.|..|:.....:.|||.|.|  |....|.:.....|::|.:
Zfish   280 VGSGRIFNISKISSDDSGEYKCRAKNDHGEKYSDPVTLDVQYAPRNISVSISGSAVIMSGDSVTL 344

  Fly   337 RCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIM-QPFSSKRVEGVGN 400
            .|:..:||. ..:.|.|  ...|..:|.:..:..:.::.:|.|.||:.|.. :.:|         
Zfish   345 NCSSDSNPL-AEINWFK--GETFVGSGRIFNISKISSDDSGEYKCRARNEHGEEYS--------- 397

  Fly   401 STVALLVRHRPGQAYIT-PNKPVVHVGNGVTLTCS--ANPPGWPVPQYRWFRDMDGDIGNTQKIL 462
            ..|.|.|::.|....:: ....|:..|:.|||:||  :|||.    :..||:      |.|.  :
Zfish   398 DPVTLDVQYPPRNVSVSISGSAVILSGDSVTLSCSSDSNPPA----EINWFK------GETS--V 450

  Fly   463 AQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVHQPPQ--FLAKLQQHMTRRVGDVDYA 525
            ..|..::|.|......|:|.|.|.|..|......:.|:|..||:  .::....|:... || ...
Zfish   451 GSGRFFNISKISSDDSGEYKCRARNAHGEKYSDPVTLDVQYPPRNISVSVSGSHVVMS-GD-SVT 513

  Fly   526 VTCSAKGKPTPQIRWIKDGTEILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPNGNQLLPN 590
            :.||:...|..:|.|.| |..::.:.::|.|....:|..|         .::.:||        |
Zfish   514 LNCSSDSNPPAEISWFK-GETLVGSGRIFSISKISSDDSG---------EYKCRAR--------N 560

  Fly   591 DRG 593
            |.|
Zfish   561 DHG 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 23/119 (19%)
IG_like 141..228 CDD:214653 20/86 (23%)
Ig 147..228 CDD:299845 19/80 (24%)
I-set 232..313 CDD:254352 15/80 (19%)
IGc2 250..302 CDD:197706 12/51 (24%)
IG_like 323..385 CDD:214653 14/61 (23%)
IGc2 330..385 CDD:197706 13/54 (24%)
Ig_2 416..501 CDD:290606 24/87 (28%)
IG_like 418..501 CDD:214653 24/84 (29%)
I-set 505..612 CDD:254352 20/91 (22%)
Ig 526..611 CDD:143165 16/68 (24%)
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC100151328XP_017211407.2 V-set 31..137 CDD:311561 22/126 (17%)
Ig_2 169..241 CDD:316418 21/88 (24%)
Ig_2 <262..319 CDD:316418 13/56 (23%)
Ig_2 333..404 CDD:316418 17/82 (21%)
Ig_2 424..489 CDD:316418 23/76 (30%)
Ig_2 509..574 CDD:316418 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.