DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC100148735

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_001919202.4 Gene:LOC100148735 / 100148735 -ID:- Length:440 Species:Danio rerio


Alignment Length:411 Identity:95/411 - (23%)
Similarity:158/411 - (38%) Gaps:78/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLLIIGQL----WLSIGLISGDDSLDTREGVDLVLKCRFTEHYDSTDFTF---YWARWTCCPTL 61
            |.||||.::    |   |:......:...:...:.:.|.||  |.:|::..   :|.:    ..:
Zfish    14 IFLLIIHRVSAAGW---GVNYSPSHICALQNSTMTISCTFT--YPNTEYQIMKVFWNK----DQV 69

  Fly    62 FENVAIGDVQLNSNY--RLDFRPSRGIYDLQIKNTSYNRDNGRFECRIK-AKGTGADVHQEFYNL 123
            :..|...|:..:..|  ||.:...:                 :..|.|: :..|..|..|.::..
Zfish    70 YNGVEFADLSEDPEYSQRLQYLGDK-----------------QQNCTIRLSHVTKKDEGQYYFRF 117

  Fly   124 TVLTAPHPPMVTPGNLAVATE---EKP--------LELTC-SSIGGSPDPMITWYREGSTVPLQS 176
            |...|.......||.:...||   |.|        :.||| ||...:..|...|||...|:    
Zfish   118 TTNVANQKWTGIPGVILSVTELQLESPERVKEGDSVRLTCRSSCKLTDTPTFIWYRNSHTL---- 178

  Fly   177 YALKGGSKNHYTNA--TLQIVPRRADDGAKYKCVVWNRAMPEGHMLET-SVTLNVNYYPR-VEVG 237
                       ||.  .|.|.|....|..:|:|.|      .||.|.: .|.|||.|.|: :.|.
Zfish   179 -----------TNIGDELNISPVSRGDAGRYRCAV------HGHTLTSPEVYLNVMYPPKSISVS 226

  Fly   238 PQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGLG 302
            ......:.......|.|..|:.| .:.:.|.:....|.:.....|.:::...:|:|.|.|.|..|
Zfish   227 ISGSAVIMSGDSVTLSCSSDSNP-PAEINWYKGKTSVRSGRILNISKISSDDSGEYKCRARNAHG 290

  Fly   303 KTGEKDIVLDVLYPPIVFIESKTHEAE--EGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGEL 365
            :.....:.|||.|||.....|.:..|.  .|::|.:.|:..:||..:|..|.|  ......:|.:
Zfish   291 EKYSDPVTLDVQYPPRSVSVSISGSAVIISGDSVTLSCSSDSNPPALNFSWFK--GETLVGSGRI 353

  Fly   366 LTLGSVRAEHAGNYICRSVNI 386
            .::.::.::.:|.|.||:.|:
Zfish   354 FSISNISSDDSGEYKCRAGNV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 17/102 (17%)
IG_like 141..228 CDD:214653 28/101 (28%)
Ig 147..228 CDD:299845 25/92 (27%)
I-set 232..313 CDD:254352 16/81 (20%)
IGc2 250..302 CDD:197706 12/51 (24%)
IG_like 323..385 CDD:214653 15/63 (24%)
IGc2 330..385 CDD:197706 13/54 (24%)
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC100148735XP_001919202.4 Ig 27..127 CDD:299845 20/125 (16%)
IG_like 143..216 CDD:214653 25/93 (27%)
IGc2 149..205 CDD:197706 19/76 (25%)
IG_like 228..301 CDD:214653 14/73 (19%)
Ig_2 232..301 CDD:290606 14/69 (20%)
IG_like 305..387 CDD:214653 17/72 (24%)
Ig_2 321..387 CDD:290606 14/56 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.