DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and sc:d0284

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_001107277.1 Gene:sc:d0284 / 100135433 ZFINID:ZDB-GENE-080327-4 Length:493 Species:Danio rerio


Alignment Length:455 Identity:106/455 - (23%)
Similarity:180/455 - (39%) Gaps:85/455 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIKLLIIGQLW--LSIGLISGDDSLDTREGVDLVLKCRFTEHYDSTDFTFYWARWTCCPTLFE 63
            ::.:.||:|.:::  ...|:..|...:...:|..:.:.|.|:..|.|:..|   |.||......|
Zfish     9 LTLVFLLMIHRVYGQSGFGVRYGSTHICALQGSTVTMSCTFSYPYRSSVET---AFWTKTQIREE 70

  Fly    64 NVAIGDVQLNSNY--RLDF-RPSRGIYDLQIKNTSYNRDNGRFECRIK---AKGTGADVHQEFYN 122
            |....|:.::..|  ||.: ..::..::|::.:.: .:|...:.||..   |..|...:.....|
Zfish    71 NEEFPDLSMDPEYNQRLQYLLNNQWNFNLRLSHVT-KKDEREYYCRFTTEIAANTWIGIPGVRLN 134

  Fly   123 LTVLTAPHPPMVTPGNLAVATEEKPLELTC-SSIGGSPDPMITWYREGSTVP---LQSYALKGGS 183
            :|.|....|..||.|:        .:.||| ||...:..|...|||....|.   |..|::....
Zfish   135 VTDLQLESPERVTEGD--------SVRLTCRSSCKLTDTPTFIWYRNSQPVARSILNVYSVSQVR 191

  Fly   184 KNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGHMLET-SVTLNVNYYPRVEV----GPQNPLK 243
            :.|..|               |.|.|      ||:...: :|.|||.|.|...|    |  :.:.
Zfish   192 RGHAGN---------------YNCGV------EGNKYTSPAVYLNVRYAPDTPVIFISG--SAVI 233

  Fly   244 VERDHVAKLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKD 308
            :..|.|. |:|..|:.| .:.:.|.:....|.:....:|.:::...:|:|.|.|.|..|......
Zfish   234 ISGDSVT-LNCSSDSNP-PAEINWFKGTTSVGSGRIFSISKISSADSGEYKCRATNDHGVKYSDP 296

  Fly   309 IVLDVLYPPIVFIESKTHEA--EEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSV 371
            :.|||.|||.....|....|  |..::|.:.|...:||..::..|.:|.......:|:     |.
Zfish   297 VTLDVKYPPRGVSVSINGSAVTESRDSVSLMCISDSNPPALSFSWFEENQSSAVGSGQ-----SF 356

  Fly   372 RAEHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTCSAN 436
            .|..:|.:.|.:.|   |..::|.:.|   ||                  .||.|..:|:..:|:
Zfish   357 SAVQSGRFYCEAHN---PHGAQRSDAV---TV------------------TVHQGASITVVAAAS 397

  Fly   437  436
            Zfish   398  397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 23/102 (23%)
IG_like 141..228 CDD:214653 21/91 (23%)
Ig 147..228 CDD:299845 21/85 (25%)
I-set 232..313 CDD:254352 19/84 (23%)
IGc2 250..302 CDD:197706 12/51 (24%)
IG_like 323..385 CDD:214653 14/63 (22%)
IGc2 330..385 CDD:197706 11/54 (20%)
Ig_2 416..501 CDD:290606 5/21 (24%)
IG_like 418..501 CDD:214653 5/19 (26%)
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
sc:d0284NP_001107277.1 IG_like 37..119 CDD:214653 19/85 (22%)
Ig 39..136 CDD:299845 22/100 (22%)
IG_like 142..208 CDD:214653 23/94 (24%)
Ig_2 142..>200 CDD:290606 19/80 (24%)
Ig_2 223..301 CDD:290606 18/81 (22%)
IG_like 228..301 CDD:214653 17/76 (22%)
Ig_2 315..384 CDD:290606 19/97 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.