DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and LOC100006649

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_021333396.1 Gene:LOC100006649 / 100006649 -ID:- Length:507 Species:Danio rerio


Alignment Length:421 Identity:97/421 - (23%)
Similarity:160/421 - (38%) Gaps:87/421 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIKLLIIGQLWLSIGLISGDD--------SLDTREGVDLVLKCRFTEHYDSTDFTFYWARWTC 57
            |.::::.::..::|.|.::|..|        .:...:...:::.|.:.........|.:|.::..
Zfish     4 MMSVRIALLPLIFLMIHIVSSADWCVKYTPEHICALKSSTVIMSCTYKYPKSHKVRTAFWTKYPP 68

  Fly    58 -----CPTLFENVA-------IGDVQLNSNYRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAK 110
                 .|.|.|:..       :||.|.|.:.||                              :.
Zfish    69 KQGQEYPDLSEDPEYSQRLQYLGDKQQNCHLRL------------------------------SH 103

  Fly   111 GTGADVHQEFYNLTVLTAPHPPMVTPG-NLAV----------ATEEKPLELTC-SSIGGSPDPMI 163
            .|..|.||.::..|........:.||| .|:|          .||...:.||| ||...:..|..
Zfish   104 VTKKDEHQYYFRFTTNVTGKMWLGTPGVRLSVTDLQLESPERVTEGDSVRLTCKSSCKLTDTPTF 168

  Fly   164 TWYREGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGHMLET-SVTLN 227
            .|||...|:     ..|.|:|       |.:.|.|.:|..:|.|.|      :||.|.: .|.||
Zfish   169 IWYRNSVTL-----TGKIGNK-------LILNPVRREDAGRYSCGV------DGHTLTSPEVYLN 215

  Fly   228 VNYYPR-VEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNRHHAG 291
            |.|.|: |.........:.......|.|..|:.|...|..|.:...:|.:.....|.:::...:|
Zfish   216 VTYPPKNVSASLNGSAVIMSGDSVTLSCSSDSNPPALNFSWYKGETFVGSGRIFNISKISSDDSG 280

  Fly   292 KYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTHEAE--EGETVLIRCNVTANPSPINVEWLKE 354
            :|.|.|.|..|:.....:.|||.|.|.....|....||  ||::|.:.|:..:|| |..:.|.| 
Zfish   281 EYKCRARNKHGEKYSDPVTLDVQYSPKSISVSINGSAEIVEGDSVTLNCSSDSNP-PAELNWFK- 343

  Fly   355 GAPDFRYTGELLTLGSVRAEHAGNYICRSVN 385
            |..... :|.|..:..:.::.:|.|.|::.|
Zfish   344 GNKSLN-SGRLFNISKISSDDSGEYKCKAKN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845 17/108 (16%)
IG_like 141..228 CDD:214653 28/98 (29%)
Ig 147..228 CDD:299845 25/82 (30%)
I-set 232..313 CDD:254352 17/81 (21%)
IGc2 250..302 CDD:197706 13/51 (25%)
IG_like 323..385 CDD:214653 18/63 (29%)
IGc2 330..385 CDD:197706 15/54 (28%)
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352
Ig 526..611 CDD:143165
IG_like 633..715 CDD:214653
Ig 635..713 CDD:143165
FN3 720..838 CDD:238020
LOC100006649XP_021333396.1 Ig 33..116 CDD:325142 16/112 (14%)
Ig_3 142..200 CDD:316449 20/69 (29%)
Ig_2 230..302 CDD:316418 15/71 (21%)
Ig_2 316..387 CDD:316418 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.