DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment capu and AT1G42980

DIOPT Version :9

Sequence 1:NP_001137784.1 Gene:capu / 33611 FlyBaseID:FBgn0000256 Length:1361 Species:Drosophila melanogaster
Sequence 2:NP_174997.2 Gene:AT1G42980 / 840896 AraportID:AT1G42980 Length:299 Species:Arabidopsis thaliana


Alignment Length:360 Identity:65/360 - (18%)
Similarity:148/360 - (41%) Gaps:84/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1013 LHVPSSEIEHAIYHIDTSVVSLEALQHMSNIQATEDELQRIKEAAGGDIP-LDHPEQFLLDISLI 1076
            :.:|..::.:|:..:|:|.|.::.::::..|..:::|:.|::.:||||.. |...|:...::.::
plant    12 IKIPLPDMLNAVLDLDSSAVIIDQIKNLIKICWSKEEMDRLRNSAGGDKEVLGKCEEIFGELMMV 76

  Fly  1077 SMASERISCIVFQAEFEESVTLLFRKLETVSQLSQQLIESEDLKLVFSIILTLGNYMNGGNRQRG 1141
            .....::....|:.|:...|:.|...:.|:...::::..|..|..:....||: ..:.|.|.:.|
plant    77 PRIEPKLRVFAFKVEYPSRVSDLKMWMHTIIAATKEITGSVKLFRIMQTSLTM-QVLRGSNVECG 140

  Fly  1142 QADGFNLDILGKLKDVKSKESHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPEPADVERAAQMDF 1206
                  ||.|.||.|      :..|:|...:  :.....:.||             :|.|::::.
plant   141 ------LDSLVKLCD------NVYLMHDFCK--LLDFGNDLVH-------------LEAASRIEL 178

  Fly  1207 EEV---QQQIFDL----NKKFLGCKRTTAKVLAASRPEIMEPFKSKMEEF---VEGADKSMAKLH 1261
            |.:   .|::||:    |.:||..:...|..:.         :::.:.:|   ::| ||.:..: 
plant   179 ETITNKMQELFDIEEEVNDEFLASENDGANFVG---------YRNVVHDFLCTIDG-DKQLLNI- 232

  Fly  1262 QSLDECRDLFLETMRFYHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNELMKK 1326
                    |:.|               :.........||.:.       :..||.|::|...:  
plant   233 --------LYAE---------------VGGLVNSYIAEYPSG-------VRFKEATNILTRFV-- 265

  Fly  1327 SKQAQIESRRNVSTKVEKSGRISLKERMLMRRSKN 1361
              :...:||..:..:.|....|..|.:|.::::.|
plant   266 --ETFYKSREEIERQAEAEKEILEKRKMNIKQNGN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capuNP_001137784.1 FH2 888..1315 CDD:214697 54/312 (17%)
AT1G42980NP_174997.2 FH2 <2..268 CDD:302999 58/328 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1922
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.