DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment capu and si:ch1073-209e23.1

DIOPT Version :9

Sequence 1:NP_001137784.1 Gene:capu / 33611 FlyBaseID:FBgn0000256 Length:1361 Species:Drosophila melanogaster
Sequence 2:XP_005173628.2 Gene:si:ch1073-209e23.1 / 101884988 ZFINID:ZDB-GENE-131121-494 Length:114 Species:Danio rerio


Alignment Length:110 Identity:29/110 - (26%)
Similarity:53/110 - (48%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1247 EEFVEGADKSMAKLHQSLDECRDLFLETMRFYHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDI 1311
            :|.::.|.||              |.:.:.::...||:..   .:.:|:..|..|..|.:|||:.
Zfish    14 DERLQAAQKS--------------FQQMVTYFGLKPKSGE---KEVSPNYIFMLWYEFCSDFKNT 61

  Fly  1312 WKKEITSLLNELMKKSKQA--QIESRRNVSTKVEKSGRISLKERM 1354
            |.:|..::..|.:|:::|.  :|.:.:.|.||  |....|||||:
Zfish    62 WNRESKNISKERLKEAQQTVQKITAEKKVETK--KINANSLKERL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
capuNP_001137784.1 FH2 888..1315 CDD:214697 15/67 (22%)
si:ch1073-209e23.1XP_005173628.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002764
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.