| Sequence 1: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005257832.1 | Gene: | LRRC46 / 90506 | HGNCID: | 25047 | Length: | 330 | Species: | Homo sapiens |
| Alignment Length: | 319 | Identity: | 70/319 - (21%) |
|---|---|---|---|
| Similarity: | 112/319 - (35%) | Gaps: | 99/319 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 LSIEGLKECIHLR----------VLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRN 141
Fly 142 LKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHL------------------ 188
Fly 189 -SNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQF 252
Fly 253 RVGEQQGLAKYLSSVCPLVG--KALENENDRKLRLILSKAQHHQRQ-----------LQEEIMD- 303
Fly 304 --------NANSSASTSP----------------SSHRKKPTSRIQSPRFSRLSGRQGS 338 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | |
| leucine-rich repeat | 32..53 | CDD:275380 | |||
| LRR_RI | <49..189 | CDD:238064 | 30/130 (23%) | ||
| LRR_4 | 76..115 | CDD:289563 | 6/37 (16%) | ||
| leucine-rich repeat | 76..97 | CDD:275380 | 4/9 (44%) | ||
| LRR_8 | 97..152 | CDD:290566 | 15/64 (23%) | ||
| LRR_4 | 97..137 | CDD:289563 | 7/49 (14%) | ||
| leucine-rich repeat | 98..119 | CDD:275380 | 4/30 (13%) | ||
| leucine-rich repeat | 120..141 | CDD:275380 | 4/20 (20%) | ||
| LRR_8 | 140..200 | CDD:290566 | 20/78 (26%) | ||
| leucine-rich repeat | 142..165 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 166..190 | CDD:275380 | 8/42 (19%) | ||
| IQ | 581..599 | CDD:197470 | |||
| LRRC46 | XP_005257832.1 | LRR_8 | 54..109 | CDD:290566 | 21/62 (34%) |
| leucine-rich repeat | 55..76 | CDD:275378 | 6/26 (23%) | ||
| LRR_4 | 75..115 | CDD:289563 | 16/41 (39%) | ||
| leucine-rich repeat | 77..98 | CDD:275378 | 8/22 (36%) | ||
| LRR_8 | 97..151 | CDD:290566 | 12/54 (22%) | ||
| LRR_4 | 97..135 | CDD:289563 | 10/38 (26%) | ||
| leucine-rich repeat | 99..120 | CDD:275378 | 7/20 (35%) | ||
| leucine-rich repeat | 121..142 | CDD:275378 | 1/20 (5%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||