DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and SDS22

DIOPT Version :10

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_012728.1 Gene:SDS22 / 853641 SGDID:S000001676 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:60/204 - (29%)
Similarity:97/204 - (47%) Gaps:23/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KHVLNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLH 74
            ||: :.:..||.|:...|         |..|:::.|.|:::...:|.|...:|.:.::..:..|.
Yeast   103 KHI-SSNVNKLTKLTSLD---------LSFNKIKHIKNLENLTDLENLYFVQNSISKIENLSTLK 157

  Fly    75 CLRELNLSFNGILSI-----EGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSIS 134
            .|:.|.|..|.:.||     |||.   :|..:.|..|:|..:.:|:...||:.|::..|.:..|.
Yeast   158 SLKNLELGGNKVHSIEPDSFEGLS---NLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIE 219

  Fly   135 DMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADN 199
            ::..|.||:||||..|.:|.:...:|.|  .|.||.:..|.|..|.   .|:|||||..|..:.|
Yeast   220 NLEELTNLEELYLSHNFITKIEGLEKNL--KLTTLDVTSNKITSLE---NLNHLSNLTDIWASFN 279

  Fly   200 PCVTMINSL 208
            .......||
Yeast   280 KIDQSFESL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 5/19 (26%)
PPP1R42 13..229 CDD:455733 58/201 (29%)
leucine-rich repeat 32..53 CDD:275380 4/20 (20%)
leucine-rich repeat 76..97 CDD:275380 9/25 (36%)
leucine-rich repeat 98..119 CDD:275380 5/20 (25%)
leucine-rich repeat 120..141 CDD:275380 5/20 (25%)
leucine-rich repeat 142..165 CDD:275380 9/22 (41%)
leucine-rich repeat 166..190 CDD:275380 9/23 (39%)
IQ 581..599 CDD:197470
SDS22NP_012728.1 leucine-rich repeat 44..67 CDD:275380
PPP1R42 <49..169 CDD:455733 18/75 (24%)
leucine-rich repeat 68..91 CDD:275380
leucine-rich repeat 92..114 CDD:275380 4/11 (36%)
PPP1R42 112..332 CDD:455733 57/194 (29%)
leucine-rich repeat 115..136 CDD:275380 5/29 (17%)
leucine-rich repeat 137..158 CDD:275380 4/20 (20%)
leucine-rich repeat 159..182 CDD:275380 9/25 (36%)
leucine-rich repeat 183..204 CDD:275380 5/20 (25%)
leucine-rich repeat 205..248 CDD:275380 15/44 (34%)
leucine-rich repeat 249..270 CDD:275380 9/23 (39%)
leucine-rich repeat 271..294 CDD:275380 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.