DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and LRRIQ1

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_011537119.1 Gene:LRRIQ1 / 84125 HGNCID:25708 Length:1760 Species:Homo sapiens


Alignment Length:840 Identity:161/840 - (19%)
Similarity:286/840 - (34%) Gaps:272/840 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IDSYLKIETLSLARNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIE 112
            ::|...::.|.|..|||:...|:|....:..|:.|.|.:..:||::.|..|::|.|:||.:..:.
Human   965 LESLKNLQQLILDHNQLINTKGLCDTPTIVYLDCSHNHLTDVEGVENCGLLQILKLQGNYLSELP 1029

  Fly   113 HLNTNVNLECLNLADNSIGSISDMS--YLRNLKELYLHGNRLTHLRQCDKCLP----TSLETLTL 171
            .|...|.|..|:|.||||.::...|  :|..|:.:.:..|.||      |.:|    .|||.|.:
Human  1030 SLENLVLLRELHLDDNSISTVEAFSSYWLPLLQNITISQNSLT------KIVPLFHFVSLEKLDV 1088

  Fly   172 AKNSINDLN------EICTLSHLSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGF 230
            :.|.::||.      :.|...|     .:|:..||.:...|      :|..:|....:|:.::|.
Human  1089 SHNCLSDLKSAIKWFDACYSLH-----ELSLTGNPLLQETN------WRDSLLKVLPALRILNGN 1142

  Fly   231 VVDPIESLKAE---------WL----------------YSQGRGRQFRVGEQQGLAKYLSSVCPL 270
            :::.....:.|         :|                |..|:|..|.:...:.|..|.      
Human  1143 ILNSNSESRTEEHNQLGSAGFLALCQSQIREFNLLIENYITGKGDVFTLDTAENLCHYF------ 1201

  Fly   271 VGKALENENDRKLRLILSKAQH-HQRQLQEEIMDNANSSASTSPSSHRKKPTSRIQSPRFSRLSG 334
                      :||.::.::.:| |:|                ...:..||..|..|         
Human  1202 ----------KKLMILSTEYRHAHER----------------GDVTITKKDESEAQ--------- 1231

  Fly   335 RQGSPESMVNSYHGNSSNNSIVSDNGSTNHSLQMSISLIENIKNDGEGFSLAGSGMSSSVTTKTY 399
                             .|.:...|         |.|.::|    |..:|.|..|...|      
Human  1232 -----------------KNHLAPTN---------SDSTLQN----GVFYSCAREGEPDS------ 1260

  Fly   400 NSTESTPRNITPNPYNDQTFISQTPSGGPLAAASKMVPVPETLMSPDVCPAAVAQRVTVTALNPQ 464
                         |...:.::....|..||:.::                         |..|.:
Human  1261 -------------PDIPEKWMDSVSSHSPLSKSA-------------------------TCENME 1287

  Fly   465 LHKTKI---NKNKDNKL-NLPRVRSP--------QLKRNQSPTSSPRRMANKCSADNMQAPEKLQ 517
            ....:|   .|.:|:|. ::|.:|.|        .|.||.               .|::..||:.
Human  1288 GRHQEILVCQKREDSKASSIPTIRIPFKEVVMTNSLLRNH---------------QNIEPSEKIM 1337

  Fly   518 QSAVLAD---------SGGFSTDDDGEQINIEKLRAIRKMAAQKQQQMHQEQLKQ-QVDNNLNCQ 572
            .:.|:..         ...|||          :|..............:|..||: :.:|.:|  
Human  1338 AAVVIQSYWRGYLMRRQTHFST----------RLHTAATEGLPNSSIKNQTILKKGKRENIVN-- 1390

  Fly   573 DRLIEHVTESSAVTIQKMWRGYHTRKKTNKDIAERLQRRRTQEYIEQLGKDMLLTKAQLENE--- 634
               |....|.:|:.||.:|:|:..|||....:.........:||.|...:|.:..:|.||.|   
Human  1391 ---IRKQREKAAILIQAVWKGFILRKKLTTALEAIKNEESDEEYREIDLEDFIFDEAALEEEWLA 1452

  Fly   635 ----RKIQQLQMQAINALWKKV-STMEVDPK--GIPAAAEQ----GEDSNGGGSGHLSLDQNSAA 688
                |...|..:.:....|.|: ..::.|..  .:|:...|    .:..|...|.|...:..|  
Human  1453 LDSTRFPSQTLLLSNQLHWPKIPGNLKWDDTSFNLPSNPAQAWLCNDKENLSSSEHTQFNSRS-- 1515

  Fly   689 VVNDLAKRCTMLTDQVQMLQSSIGTIVNCLTMVCNLPQDAIKKQAE---IIDCSSTQTDLIAVHT 750
                 ..:.:..|.:.:..:.|:            |..:..||.:|   ..|.|:.|..|     
Human  1516 -----ENKTSSWTPESKTSRKSL------------LKSEKEKKISEEWGFKDISTAQQML----- 1558

  Fly   751 PQIEDLTNFPFTKTRPST--LALESKHEAALACPKIDELNDVDLKETQEDS--ENLDKDP 806
            .:.:.:.:....|...||  |||...:|..::.||..:     :.:.:.|.  |.:::||
Human  1559 KRAQKMKSKKLKKKIDSTVRLALFKNNENKVSLPKSPK-----MVQPRRDGYFEGIEEDP 1613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380
leucine-rich repeat 32..53 CDD:275380 1/4 (25%)
LRR_RI <49..189 CDD:238064 45/151 (30%)
LRR_4 76..115 CDD:289563 11/38 (29%)
leucine-rich repeat 76..97 CDD:275380 6/20 (30%)
LRR_8 97..152 CDD:290566 18/56 (32%)
LRR_4 97..137 CDD:289563 14/39 (36%)
leucine-rich repeat 98..119 CDD:275380 6/20 (30%)
leucine-rich repeat 120..141 CDD:275380 9/22 (41%)
LRR_8 140..200 CDD:290566 16/69 (23%)
leucine-rich repeat 142..165 CDD:275380 6/26 (23%)
leucine-rich repeat 166..190 CDD:275380 8/29 (28%)
IQ 581..599 CDD:197470 7/17 (41%)
LRRIQ1XP_011537119.1 DUF4515 164..343 CDD:291649
LRR_4 818..856 CDD:289563
leucine-rich repeat 820..841 CDD:275380
leucine-rich repeat 842..862 CDD:275380
leucine-rich repeat 863..884 CDD:275380
leucine-rich repeat 885..920 CDD:275380
leucine-rich repeat 921..970 CDD:275380 1/4 (25%)
LRR_RI <963..1095 CDD:238064 41/135 (30%)
leucine-rich repeat 971..992 CDD:275380 7/20 (35%)
leucine-rich repeat 993..1014 CDD:275380 6/20 (30%)
leucine-rich repeat 1015..1036 CDD:275380 6/20 (30%)
LRR_8 1037..1091 CDD:290566 19/59 (32%)
leucine-rich repeat 1037..1060 CDD:275380 9/22 (41%)
leucine-rich repeat 1083..1108 CDD:275380 7/24 (29%)
leucine-rich repeat 1109..1135 CDD:275380 7/36 (19%)
IQ 1338..1354 CDD:197470 1/15 (7%)
IQ 1394..1415 CDD:197470 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.