Sequence 1: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021327254.1 | Gene: | drc3 / 777619 | ZFINID: | ZDB-GENE-061103-349 | Length: | 514 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 72/270 - (26%) |
---|---|---|---|
Similarity: | 117/270 - (43%) | Gaps: | 66/270 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSGDESGEEKHVLNLSKQKLKKVPKQDDA--------HSIRQLILDENELQKIDNIDSYLKIETL 57
Fly 58 SLARNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLEC 122
Fly 123 LNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSH 187
Fly 188 LSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGFVVD--PIESLKAEWLYSQGRGR 250
Fly 251 QFRVGEQQGL 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | 3/27 (11%) |
leucine-rich repeat | 32..53 | CDD:275380 | 6/20 (30%) | ||
LRR_RI | <49..189 | CDD:238064 | 44/139 (32%) | ||
LRR_4 | 76..115 | CDD:289563 | 18/38 (47%) | ||
leucine-rich repeat | 76..97 | CDD:275380 | 11/20 (55%) | ||
LRR_8 | 97..152 | CDD:290566 | 18/54 (33%) | ||
LRR_4 | 97..137 | CDD:289563 | 15/39 (38%) | ||
leucine-rich repeat | 98..119 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | 8/20 (40%) | ||
LRR_8 | 140..200 | CDD:290566 | 9/59 (15%) | ||
leucine-rich repeat | 142..165 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 166..190 | CDD:275380 | 7/23 (30%) | ||
IQ | 581..599 | CDD:197470 | |||
drc3 | XP_021327254.1 | leucine-rich repeat | 39..58 | CDD:275380 | 6/18 (33%) |
leucine-rich repeat | 59..80 | CDD:275378 | 6/20 (30%) | ||
LRR_9 | 61..198 | CDD:317038 | 52/188 (28%) | ||
leucine-rich repeat | 81..102 | CDD:275378 | 11/20 (55%) | ||
leucine-rich repeat | 103..124 | CDD:275378 | 9/20 (45%) | ||
leucine-rich repeat | 125..149 | CDD:275378 | 9/44 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |