DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and Lrrc56

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_006536303.1 Gene:Lrrc56 / 70552 MGIID:1917802 Length:559 Species:Mus musculus


Alignment Length:541 Identity:101/541 - (18%)
Similarity:188/541 - (34%) Gaps:148/541 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LNLSKQKLKKVPKQDDAHSIRQLILDEN----ELQKIDNIDSYLKIETLSLARNQLLRMYGVC-- 71
            ||....:.|::....|.|  |:..::|.    .||.:..:|..           ||:|:..:|  
Mouse    35 LNNPHPQNKRLGSHGDIH--RERWVEERLSPARLQALAQVDDL-----------QLVRVLEMCVD 86

  Fly    72 -RLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNV-NLECLNLADNSIGSIS 134
             |.:.|....|....::.            |.|..:.:.::..|.|:: :|:.|.||...:..:.
Mouse    87 TRKNSLGNFGLYLPNLIQ------------LKLNHSYLGSLRDLGTSLGHLQVLWLARCGLTDLD 139

  Fly   135 DMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADN 199
            .:.....|||||:..|.::.|...  ||...||.|.|..|::.||.::..|.....|..:::..|
Mouse   140 GIGSFLELKELYVSYNNISDLSPL--CLLEQLEVLDLEGNNVEDLGQMRYLQLCPRLAMLTLEGN 202

  Fly   200 -PCV-----TMINSLDGFDYRPFVLNWCMSLKYIDGFVVDPI----------ESLKAEWLYSQGR 248
             .|:     ....:..|::||..|......|     .|:|.:          ::|..:||     
Mouse   203 LVCLKPDPGPSNKAPQGYNYRAEVKKLIPQL-----HVLDEVPTTCTSAPAPQTLSQDWL----- 257

  Fly   249 GRQFRVGEQQGLAKYLSSVCPLVGKALENENDRKLRLILSKAQHHQRQLQEEIMDNANSSASTSP 313
                                 :|.:|::..:  .|.::|.:            :|:.:.:     
Mouse   258 ---------------------MVKEAIKEGS--VLDILLPR------------LDDPHGA----- 282

  Fly   314 SSHRKKPTSRIQSPRFSRLSGRQGSPESMVNSYHGNSSNNSIVSDNGST-NHSLQMSISLIENIK 377
            :..:..||          |...:..|.::.....|......::|:|.:| :|:..::        
Mouse   283 TIRKFDPT----------LPVPETQPWALSLLVPGGPLPEGLLSENPATEDHASNLT-------- 329

  Fly   378 NDGEGFSLAGSGMSSSVTTKTYNSTESTPRNITPNPYNDQTFISQTPSGGPLAAASKMVPVPETL 442
             .|.|..|.|            |.|:...:.  .|.|.:...:.|.|...|..|.....|.|:..
Mouse   330 -HGPGQVLCG------------NPTKGLRKR--RNQYQEWAPLEQMPPHRPDLAIRPSTPRPDPA 379

  Fly   443 MSPDVCPAAVAQRVTVTALNPQLHKTKINKNKDNKLNLPRVRSPQLKRNQSPTSSPRRMANKCSA 507
            .|.|:....: :..|...|.|.|.:         :|...:.||.|::. |.|...|....::...
Mouse   380 ESCDLAMTGL-RAWTEPGLRPLLQR---------QLEFQQERSAQVQA-QDPQKDPVEQEDQTGP 433

  Fly   508 DNMQAPEKLQQSAVLADSGGF 528
            .....|.:|...  |:.:.||
Mouse   434 KTSLTPPRLVSE--LSRTSGF 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 4/17 (24%)
leucine-rich repeat 32..53 CDD:275380 5/24 (21%)
LRR_RI <49..189 CDD:238064 33/143 (23%)
LRR_4 76..115 CDD:289563 4/38 (11%)
leucine-rich repeat 76..97 CDD:275380 2/20 (10%)
LRR_8 97..152 CDD:290566 14/55 (25%)
LRR_4 97..137 CDD:289563 8/40 (20%)
leucine-rich repeat 98..119 CDD:275380 4/21 (19%)
leucine-rich repeat 120..141 CDD:275380 4/20 (20%)
LRR_8 140..200 CDD:290566 19/60 (32%)
leucine-rich repeat 142..165 CDD:275380 9/22 (41%)
leucine-rich repeat 166..190 CDD:275380 8/23 (35%)
IQ 581..599 CDD:197470
Lrrc56XP_006536303.1 internalin_A <99..>202 CDD:380193 26/116 (22%)
leucine-rich repeat 102..124 CDD:275380 4/33 (12%)
leucine-rich repeat 125..146 CDD:275380 4/20 (20%)
leucine-rich repeat 147..168 CDD:275380 9/22 (41%)
leucine-rich repeat 169..193 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.