DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and Lrrc46

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_081302.2 Gene:Lrrc46 / 69297 MGIID:1916547 Length:323 Species:Mus musculus


Alignment Length:358 Identity:71/358 - (19%)
Similarity:122/358 - (34%) Gaps:124/358 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KECIHL-------RVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELYLHGN 150
            :|.:|:       |.|...|:...:.:..:|...||.:.|....|..|.::..|||:..|||..|
Mouse    16 EEGVHITEALITKRNLTFPGDEDLSEKMFHTLGELETVRLDGEGITCIGNLEKLRNIHSLYLQSN 80

  Fly   151 RLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHL-------------------SNLLSISI 196
            ::..:... .|: |||..|:||:|.|..:..:..|.:|                   .:||.:::
Mouse    81 KIQRIENL-ACI-TSLRFLSLARNQIRHVENLLDLQYLQFLDLSENLIETLKLDELPESLLILNL 143

  Fly   197 ADNPCVT-------MINSLD---GFDYRPFVLNW----------------------CMSLKYIDG 229
            ..|||..       :|.:|.   ..|.:|.:..|                      |..    .|
Mouse   144 CGNPCTNQEGYRKMVIGALPLLLDLDKQPILERWTSDEEDKSSDDDDEFPELNGPFCAE----RG 204

  Fly   230 FVVDPIESLKAEWLYSQGRGRQFRVGEQQGLAKYLSSV--------------CPLVGKALENEND 280
            |..|    |:.| |:.....||     |..|.::||.:              .|:.|.......|
Mouse   205 FFKD----LEQE-LHQHQERRQ-----QAALTEHLSRMETQPVLTDLPLLPAVPMAGDCSSTATD 259

  Fly   281 RKLRLILSKAQHHQRQLQEEIMDNANSSASTSPSSHRKKPTSRIQSPRFSRLSGRQGSPESMVNS 345
            :..:....||                 ::||..:|..||..|:.|.   |.:..|:|        
Mouse   260 QPGKESAPKA-----------------TSSTQTASTTKKQVSKNQK---SSVQARKG-------- 296

  Fly   346 YHGNSSNNSIVSDNGSTNHSLQMSISLIENIKN 378
                    ::.:....|:.:...|::.:.|.|:
Mouse   297 --------ALAATTSKTSQAATPSMTKMTNKKS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380
leucine-rich repeat 32..53 CDD:275380
LRR_RI <49..189 CDD:238064 29/121 (24%)
LRR_4 76..115 CDD:289563 5/28 (18%)
leucine-rich repeat 76..97 CDD:275380 1/3 (33%)
LRR_8 97..152 CDD:290566 17/61 (28%)
LRR_4 97..137 CDD:289563 10/46 (22%)
leucine-rich repeat 98..119 CDD:275380 4/27 (15%)
leucine-rich repeat 120..141 CDD:275380 6/20 (30%)
LRR_8 140..200 CDD:290566 19/78 (24%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
leucine-rich repeat 166..190 CDD:275380 8/42 (19%)
IQ 581..599 CDD:197470
Lrrc46NP_081302.2 LRR 1 49..70 5/20 (25%)
LRR_4 50..89 CDD:289563 12/39 (31%)
leucine-rich repeat 50..71 CDD:275378 6/20 (30%)
LRR_8 70..126 CDD:290566 17/57 (30%)
LRR_4 71..110 CDD:289563 14/40 (35%)
LRR 2 71..92 6/22 (27%)
leucine-rich repeat 72..93 CDD:275378 5/22 (23%)
LRR_4 92..130 CDD:289563 10/37 (27%)
LRR 3 93..114 7/20 (35%)
leucine-rich repeat 94..115 CDD:275378 7/20 (35%)
LRR 4 115..135 1/19 (5%)
leucine-rich repeat 116..137 CDD:275378 1/20 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..323 18/109 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.