DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and Ppp1r7

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_075689.1 Gene:Ppp1r7 / 66385 MGIID:1913635 Length:361 Species:Mus musculus


Alignment Length:284 Identity:70/284 - (24%)
Similarity:114/284 - (40%) Gaps:89/284 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGDESGEEKH-----VLNLSKQKLKK--------------------------------------- 22
            ||||.| :||     |.|||:|.||.                                       
Mouse    27 SGDEEG-KKHGGGGIVANLSEQSLKDGVDRGAEDPEEEHELAVDMETINLDRDAEDVDLTHYRIG 90

  Fly    23 -----------------------VPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQL 64
                                   :...::..|:|:|.|.:|:::||:|:::..::|.|.::.|.|
Mouse    91 KIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNML 155

  Fly    65 LRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNS 129
            ..:.|:.:|..|::|.|..|.|..||.:.....|::|.|..|.|:.||:::|..|||.|.|..|.
Mouse   156 RNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNK 220

  Fly   130 IGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSI------------------ 176
            |..:.::..|.||..|.:..|||..:......:  :|..|.|:.|.|                  
Mouse   221 ITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLV--NLRELYLSNNGIEVIEGLENNNKLTMLDIA 283

  Fly   177 -NDLNEICTLSHLSNLLSISIADN 199
             |.:.:|..:|||:.|....:.||
Mouse   284 SNRIKKIENISHLTELQEFWMNDN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 8/86 (9%)
leucine-rich repeat 32..53 CDD:275380 7/20 (35%)
LRR_RI <49..189 CDD:238064 44/158 (28%)
LRR_4 76..115 CDD:289563 14/38 (37%)
leucine-rich repeat 76..97 CDD:275380 7/20 (35%)
LRR_8 97..152 CDD:290566 20/54 (37%)
LRR_4 97..137 CDD:289563 15/39 (38%)
leucine-rich repeat 98..119 CDD:275380 8/20 (40%)
leucine-rich repeat 120..141 CDD:275380 7/20 (35%)
LRR_8 140..200 CDD:290566 19/79 (24%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
leucine-rich repeat 166..190 CDD:275380 10/42 (24%)
IQ 581..599 CDD:197470
Ppp1r7NP_075689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 14/37 (38%)
LRR 1 78..99 0/20 (0%)
LRR_4 99..140 CDD:289563 8/40 (20%)
LRR 2 100..121 0/20 (0%)
leucine-rich repeat 101..122 CDD:275380 0/20 (0%)
LRR_4 121..163 CDD:289563 13/41 (32%)
LRR_8 122..177 CDD:290566 18/54 (33%)
LRR 3 122..143 8/20 (40%)
leucine-rich repeat 123..144 CDD:275380 7/20 (35%)
LRR_4 143..185 CDD:289563 13/41 (32%)
LRR 4 144..165 5/20 (25%)
leucine-rich repeat 145..166 CDD:275380 6/20 (30%)
LRR_8 165..221 CDD:290566 21/55 (38%)
LRR 5 166..187 7/20 (35%)
leucine-rich repeat 167..188 CDD:275380 7/20 (35%)
LRR_4 188..227 CDD:289563 15/38 (39%)
LRR 6 188..209 8/20 (40%)
leucine-rich repeat 189..210 CDD:275380 8/20 (40%)
LRR_4 209..251 CDD:289563 14/41 (34%)
LRR 7 210..231 7/20 (35%)
leucine-rich repeat 211..232 CDD:275380 7/20 (35%)
LRR_8 231..287 CDD:290566 12/57 (21%)
LRR 8 232..253 6/20 (30%)
leucine-rich repeat 233..254 CDD:275380 5/22 (23%)
LRR_4 254..295 CDD:289563 7/40 (18%)
LRR 9 254..275 5/20 (25%)
leucine-rich repeat 255..276 CDD:275380 5/20 (25%)
LRR_4 276..317 CDD:289563 8/32 (25%)
LRR 10 276..297 4/20 (20%)
leucine-rich repeat 277..298 CDD:275380 5/20 (25%)
LRR 11 298..319 3/10 (30%)
LRRcap 337..355 CDD:197729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.