Sequence 1: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_075689.1 | Gene: | Ppp1r7 / 66385 | MGIID: | 1913635 | Length: | 361 | Species: | Mus musculus |
Alignment Length: | 284 | Identity: | 70/284 - (24%) |
---|---|---|---|
Similarity: | 114/284 - (40%) | Gaps: | 89/284 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SGDESGEEKH-----VLNLSKQKLKK--------------------------------------- 22
Fly 23 -----------------------VPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQL 64
Fly 65 LRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNS 129
Fly 130 IGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSI------------------ 176
Fly 177 -NDLNEICTLSHLSNLLSISIADN 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | 8/86 (9%) |
leucine-rich repeat | 32..53 | CDD:275380 | 7/20 (35%) | ||
LRR_RI | <49..189 | CDD:238064 | 44/158 (28%) | ||
LRR_4 | 76..115 | CDD:289563 | 14/38 (37%) | ||
leucine-rich repeat | 76..97 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 97..152 | CDD:290566 | 20/54 (37%) | ||
LRR_4 | 97..137 | CDD:289563 | 15/39 (38%) | ||
leucine-rich repeat | 98..119 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 140..200 | CDD:290566 | 19/79 (24%) | ||
leucine-rich repeat | 142..165 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 166..190 | CDD:275380 | 10/42 (24%) | ||
IQ | 581..599 | CDD:197470 | |||
Ppp1r7 | NP_075689.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..64 | 14/37 (38%) | |
LRR 1 | 78..99 | 0/20 (0%) | |||
LRR_4 | 99..140 | CDD:289563 | 8/40 (20%) | ||
LRR 2 | 100..121 | 0/20 (0%) | |||
leucine-rich repeat | 101..122 | CDD:275380 | 0/20 (0%) | ||
LRR_4 | 121..163 | CDD:289563 | 13/41 (32%) | ||
LRR_8 | 122..177 | CDD:290566 | 18/54 (33%) | ||
LRR 3 | 122..143 | 8/20 (40%) | |||
leucine-rich repeat | 123..144 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 143..185 | CDD:289563 | 13/41 (32%) | ||
LRR 4 | 144..165 | 5/20 (25%) | |||
leucine-rich repeat | 145..166 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 165..221 | CDD:290566 | 21/55 (38%) | ||
LRR 5 | 166..187 | 7/20 (35%) | |||
leucine-rich repeat | 167..188 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 188..227 | CDD:289563 | 15/38 (39%) | ||
LRR 6 | 188..209 | 8/20 (40%) | |||
leucine-rich repeat | 189..210 | CDD:275380 | 8/20 (40%) | ||
LRR_4 | 209..251 | CDD:289563 | 14/41 (34%) | ||
LRR 7 | 210..231 | 7/20 (35%) | |||
leucine-rich repeat | 211..232 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 231..287 | CDD:290566 | 12/57 (21%) | ||
LRR 8 | 232..253 | 6/20 (30%) | |||
leucine-rich repeat | 233..254 | CDD:275380 | 5/22 (23%) | ||
LRR_4 | 254..295 | CDD:289563 | 7/40 (18%) | ||
LRR 9 | 254..275 | 5/20 (25%) | |||
leucine-rich repeat | 255..276 | CDD:275380 | 5/20 (25%) | ||
LRR_4 | 276..317 | CDD:289563 | 8/32 (25%) | ||
LRR 10 | 276..297 | 4/20 (20%) | |||
leucine-rich repeat | 277..298 | CDD:275380 | 5/20 (25%) | ||
LRR 11 | 298..319 | 3/10 (30%) | |||
LRRcap | 337..355 | CDD:197729 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |