DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and lrrc61

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001036219.1 Gene:lrrc61 / 553439 ZFINID:ZDB-GENE-060616-245 Length:260 Species:Danio rerio


Alignment Length:315 Identity:75/315 - (23%)
Similarity:118/315 - (37%) Gaps:100/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DENELQKID-----------NIDS--YLKIETLSLARNQLLRMYGVCRLHCLRE------LNLSF 83
            ||.|..||.           :::|  :||::.|           |:..|.|:.|      |:||.
Zfish     8 DETECSKITTMLLKSHTGEFDLESILFLKLKNL-----------GIYDLGCIGECINLERLDLSG 61

  Fly    84 NGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELYLH 148
            |.|.::..|.....|..|||..|.|..:|.|.|..:|:.||:|.|.|.|:.::..|::|:.    
Zfish    62 NNITNLGPLSPLRRLLSLNLSANRISNLEPLATCESLQSLNVAGNVISSVDNLHSLKSLRR---- 122

  Fly   149 GNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTMINSLDGFDY 213
                             ||.:.|..|:.|..|.:|              .||           .|
Zfish   123 -----------------LENIRLKDNTYNFTNPVC--------------KNP-----------SY 145

  Fly   214 RPFVLNWCMSLKYIDGFVV------------DPIESLKAEWLYSQGRGRQFRVGE---QQGLAKY 263
            ||.:|....::|.:||..|            |..:|:|| .:|..|:..:.|..|   .....:.
Zfish   146 RPLILEIFPNMKVLDGERVVGRGSDLYQLCKDIDDSIKA-GMYKNGQLLEVRETEPWVDDSFWEI 209

  Fly   264 LSSVCPLVGKALENEND--RKLRLILSKAQHHQRQLQEEIMDNANSSASTSPSSH 316
            ..|...:|.:|.:..:|  .:.||:.|:|.|...|      :..|.|....|..:
Zfish   210 KRSNNAIVDEAYKQFSDVLHECRLLNSRAGHLISQ------NERNISLKNQPKQY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380
leucine-rich repeat 32..53 CDD:275380 6/27 (22%)
LRR_RI <49..189 CDD:238064 39/147 (27%)
LRR_4 76..115 CDD:289563 14/44 (32%)
leucine-rich repeat 76..97 CDD:275380 7/26 (27%)
LRR_8 97..152 CDD:290566 18/54 (33%)
LRR_4 97..137 CDD:289563 16/39 (41%)
leucine-rich repeat 98..119 CDD:275380 9/20 (45%)
leucine-rich repeat 120..141 CDD:275380 8/20 (40%)
LRR_8 140..200 CDD:290566 8/59 (14%)
leucine-rich repeat 142..165 CDD:275380 1/22 (5%)
leucine-rich repeat 166..190 CDD:275380 7/23 (30%)
IQ 581..599 CDD:197470
lrrc61NP_001036219.1 leucine-rich repeat 54..81 CDD:275378 8/26 (31%)
leucine-rich repeat 98..122 CDD:275378 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.