DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and dnal1

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_012823845.1 Gene:dnal1 / 549066 XenbaseID:XB-GENE-983792 Length:201 Species:Xenopus tropicalis


Alignment Length:172 Identity:47/172 - (27%)
Similarity:78/172 - (45%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGDESGEEKHVLNLSKQKLKKVPKQDDAHS----IRQLILDENELQKIDNIDSYLKIETLSLARN 62
            :|.::||.|.| .|..| :..:.|.|.:.|    ..:|.|..|.::||.|::....:..|||.||
 Frog    27 TGQKAGEAKEV-KLYAQ-IPPIEKMDASLSTLVNCEKLSLSTNCIEKIANLNGLKFLRILSLGRN 89

  Fly    63 QLLRMYGVCRL-HCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLA 126
            .:..:.|:..: ..|.||.:|:|.|..::|:.....|:||.:..|.:|.....:....|..|   
 Frog    90 NIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWAEFSKLGELPLL--- 151

  Fly   127 DNSIGSISDMSYLRN-LKELY-LHGN-------RLTHLRQCD 159
                   .||.::.| |:|.: ..||       ||..|::.|
 Frog   152 -------EDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 5/19 (26%)
leucine-rich repeat 32..53 CDD:275380 6/20 (30%)
LRR_RI <49..189 CDD:238064 31/121 (26%)
LRR_4 76..115 CDD:289563 12/38 (32%)
leucine-rich repeat 76..97 CDD:275380 7/20 (35%)
LRR_8 97..152 CDD:290566 14/63 (22%)
LRR_4 97..137 CDD:289563 8/39 (21%)
leucine-rich repeat 98..119 CDD:275380 5/20 (25%)
leucine-rich repeat 120..141 CDD:275380 4/20 (20%)
LRR_8 140..200 CDD:290566 9/29 (31%)
leucine-rich repeat 142..165 CDD:275380 8/26 (31%)
leucine-rich repeat 166..190 CDD:275380
IQ 581..599 CDD:197470
dnal1XP_012823845.1 internalin_A 53..>163 CDD:380193 31/119 (26%)
leucine-rich repeat 59..80 CDD:275378 6/20 (30%)
leucine-rich repeat 81..99 CDD:275378 6/17 (35%)
leucine-rich repeat 104..125 CDD:275382 7/20 (35%)
leucine-rich repeat 126..149 CDD:275382 5/22 (23%)
leucine-rich repeat 151..181 CDD:275382 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.