Sequence 1: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006054.1 | Gene: | lrrc23 / 450033 | ZFINID: | ZDB-GENE-041010-153 | Length: | 326 | Species: | Danio rerio |
Alignment Length: | 212 | Identity: | 64/212 - (30%) |
---|---|---|---|
Similarity: | 101/212 - (47%) | Gaps: | 20/212 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 DENELQKIDN--IDSYLKIETLSLARNQLLRMYGVCRLHCLRELNLSFNGILSIEGL--KECIHL 98
Fly 99 RVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCD---K 160
Fly 161 CLPTSLETLTLAKNSINDLNEICTLSHLSNLL-SISIADNPCVTMINSLDGFDYRPFVLNWCMSL 224
Fly 225 KYIDGFVVDPIESLKAE 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | |
leucine-rich repeat | 32..53 | CDD:275380 | 4/16 (25%) | ||
LRR_RI | <49..189 | CDD:238064 | 44/144 (31%) | ||
LRR_4 | 76..115 | CDD:289563 | 15/40 (38%) | ||
leucine-rich repeat | 76..97 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 97..152 | CDD:290566 | 18/54 (33%) | ||
LRR_4 | 97..137 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 98..119 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 140..200 | CDD:290566 | 17/63 (27%) | ||
leucine-rich repeat | 142..165 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 166..190 | CDD:275380 | 7/23 (30%) | ||
IQ | 581..599 | CDD:197470 | |||
lrrc23 | NP_001006054.1 | leucine-rich repeat | 64..83 | CDD:275380 | |
LRR_4 | 65..102 | CDD:289563 | |||
LRR_8 | 83..140 | CDD:290566 | 8/27 (30%) | ||
leucine-rich repeat | 84..105 | CDD:275380 | |||
leucine-rich repeat | 106..129 | CDD:275380 | 4/16 (25%) | ||
leucine-rich repeat | 130..150 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 149..206 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 151..174 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 175..195 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 194..251 | CDD:290566 | 20/60 (33%) | ||
LRR_4 | 194..235 | CDD:289563 | 14/40 (35%) | ||
leucine-rich repeat | 196..217 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 216..258 | CDD:289563 | 13/45 (29%) | ||
leucine-rich repeat | 218..240 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 241..262 | CDD:275380 | 7/20 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |