| Sequence 1: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001006731.1 | Gene: | ppp1r7 / 448394 | XenbaseID: | XB-GENE-964679 | Length: | 346 | Species: | Xenopus tropicalis |
| Alignment Length: | 201 | Identity: | 60/201 - (29%) |
|---|---|---|---|
| Similarity: | 104/201 - (51%) | Gaps: | 6/201 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 EKHVLNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRL 73
Fly 74 HCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSY 138
Fly 139 LRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVT 203
Fly 204 MINSLD 209 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | 3/19 (16%) |
| leucine-rich repeat | 32..53 | CDD:275380 | 5/20 (25%) | ||
| LRR_RI | <49..189 | CDD:238064 | 44/139 (32%) | ||
| LRR_4 | 76..115 | CDD:289563 | 18/38 (47%) | ||
| leucine-rich repeat | 76..97 | CDD:275380 | 10/20 (50%) | ||
| LRR_8 | 97..152 | CDD:290566 | 20/54 (37%) | ||
| LRR_4 | 97..137 | CDD:289563 | 14/39 (36%) | ||
| leucine-rich repeat | 98..119 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 120..141 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 140..200 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 142..165 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 166..190 | CDD:275380 | 8/23 (35%) | ||
| IQ | 581..599 | CDD:197470 | |||
| ppp1r7 | NP_001006731.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..46 | ||
| internalin_A | 46..>320 | CDD:380193 | 60/201 (30%) | ||
| LRR 1 | 63..84 | 4/20 (20%) | |||
| LRR 2 | 85..106 | 5/20 (25%) | |||
| leucine-rich repeat | 86..104 | CDD:275380 | 5/17 (29%) | ||
| LRR 3 | 107..128 | 4/20 (20%) | |||
| leucine-rich repeat | 108..129 | CDD:275380 | 5/20 (25%) | ||
| LRR 4 | 129..150 | 10/20 (50%) | |||
| leucine-rich repeat | 130..151 | CDD:275380 | 10/20 (50%) | ||
| LRR 5 | 151..172 | 9/20 (45%) | |||
| leucine-rich repeat | 152..173 | CDD:275380 | 8/20 (40%) | ||
| LRR 6 | 173..194 | 5/20 (25%) | |||
| leucine-rich repeat | 174..192 | CDD:275380 | 5/17 (29%) | ||
| leucine-rich repeat | 193..217 | CDD:275380 | 9/28 (32%) | ||
| LRR 7 | 195..216 | 6/25 (24%) | |||
| LRR 8 | 217..238 | 6/20 (30%) | |||
| leucine-rich repeat | 218..239 | CDD:275380 | 7/20 (35%) | ||
| LRR 9 | 239..260 | 6/20 (30%) | |||
| leucine-rich repeat | 240..261 | CDD:275380 | 5/19 (26%) | ||
| LRR 10 | 261..282 | ||||
| leucine-rich repeat | 262..283 | CDD:275380 | |||
| LRR 11 | 283..304 | ||||
| LRRcap | 322..340 | CDD:197729 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||