DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and dnaaf11

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001002311.1 Gene:dnaaf11 / 432388 ZFINID:ZDB-GENE-040827-2 Length:440 Species:Danio rerio


Alignment Length:467 Identity:112/467 - (23%)
Similarity:179/467 - (38%) Gaps:105/467 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LRELNLSFNGILSIEGL-KECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYL 139
            |.||:|....|..||.: |.|..|::|.|:.|.|..||::.....||.||||.|:|..|.     
Zfish    23 LEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIE----- 82

  Fly   140 RNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTM 204
                          :|..|:     ||:.|.|..||:..|:.:.||.|..:|..:.:..|||.  
Zfish    83 --------------NLEGCE-----SLQKLDLTVNSVGRLSSVETLKHNLHLKELYLVGNPCA-- 126

  Fly   205 INSLDGFDYRPFVLNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQFRVGEQQGLAKYLSSVCP 269
              ...|  ||.:|:.....|:.:||..:...|.::|   ..:....:.||.:|:  .|||..   
Zfish   127 --EYQG--YRQYVVATVPQLQSLDGKEISRAERIQA---LQELDAVRTRVLQQE--TKYLEE--- 179

  Fly   270 LVGKALENENDR-KLRLILSKAQHHQRQLQEEIMDNANSSASTSPSSHRKK---------PTSRI 324
             ..|...|.|:. ::...||::|:..:|..|     ::|...|......::         |.||:
Zfish   180 -REKQKSNANEHPEINQSLSESQNGTQQYPE-----SSSKTHTEAEDEEREFWEKPCPFTPESRL 238

  Fly   325 QSPRFSRLSGRQGSPESMVNSYHGNSSNNSIVSDNGSTN-HSLQMSISLIENIKNDGEGFSLAGS 388
            ::.|  .|..::.:.|.........:....|..|....| :..::..||.|:..|          
Zfish   239 EAHR--HLEEKRRANEKEKEKPKTKTPRTLITPDGRVLNVNERKLDFSLSEDENN---------- 291

  Fly   389 GMSSSVTTKTYNSTESTPRNITPNPYNDQTFISQTPSGGPLAAASKMVPVPETLMSPDVCP-AAV 452
              ...:....|...:|:..::...|    .::..|..|          .|.:.::..:|.| ::.
Zfish   292 --CLLLDLNVYRHMDSSLLDVDVQP----MYVRVTVKG----------KVFQLVLPAEVKPDSSS 340

  Fly   453 AQRVTVTALNPQLHKTKI--NKNKDNKLNLPRVRSPQLKRNQSPTSSPRRMANKCSADNMQAP-- 513
            |||...|.     |...|  ..|:|.|   |:      ||:..|||......||  .|...||  
Zfish   341 AQRSQTTG-----HLLLILPLANEDVK---PK------KRSIRPTSVTSNQNNK--KDTRAAPRR 389

  Fly   514 EKLQQSAVLADS 525
            |.|:....||.|
Zfish   390 ELLEVDPGLAGS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380
leucine-rich repeat 32..53 CDD:275380
LRR_RI <49..189 CDD:238064 37/113 (33%)
LRR_4 76..115 CDD:289563 16/39 (41%)
leucine-rich repeat 76..97 CDD:275380 9/21 (43%)
LRR_8 97..152 CDD:290566 16/54 (30%)
LRR_4 97..137 CDD:289563 16/39 (41%)
leucine-rich repeat 98..119 CDD:275380 7/20 (35%)
leucine-rich repeat 120..141 CDD:275380 9/20 (45%)
LRR_8 140..200 CDD:290566 13/59 (22%)
leucine-rich repeat 142..165 CDD:275380 2/22 (9%)
leucine-rich repeat 166..190 CDD:275380 9/23 (39%)
IQ 581..599 CDD:197470
dnaaf11NP_001002311.1 LRR 1 20..43 8/19 (42%)
leucine-rich repeat 23..45 CDD:275378 9/21 (43%)
LRR 2 44..65 7/20 (35%)
LRR_8 46..98 CDD:290566 22/75 (29%)
LRR_4 46..86 CDD:289563 17/58 (29%)
leucine-rich repeat 46..67 CDD:275378 7/20 (35%)
LRR 3 66..89 11/46 (24%)
leucine-rich repeat 68..89 CDD:275378 11/44 (25%)
leucine-rich repeat 90..114 CDD:275378 9/23 (39%)
LRR 4 90..110 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..267 16/99 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..440 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.