DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and sds22

DIOPT Version :10

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster


Alignment Length:179 Identity:60/179 - (33%)
Similarity:93/179 - (51%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLR 77
            |.|...::.|:...||...:..|.:..|.|.||:|:|..:|:|.:....|::.::..:..|..|.
  Fly    88 LELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLT 152

  Fly    78 ELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNL 142
            .|.|..|.:..||.::..::||.|.|..|.|..||:|:|.||||.|:|..|.|..|.::..|.||
  Fly   153 MLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANL 217

  Fly   143 KELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNL 191
            :|||:..|.:..:....:  .|.||||.||||.:..:..:..|..|..|
  Fly   218 RELYVSENGVETIENLSE--NTKLETLDLAKNRLKGIANLEKLELLEEL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 5/17 (29%)
PPP1R42 13..229 CDD:455733 60/179 (34%)
leucine-rich repeat 32..53 CDD:275380 7/20 (35%)
leucine-rich repeat 76..97 CDD:275380 6/20 (30%)
leucine-rich repeat 98..119 CDD:275380 10/20 (50%)
leucine-rich repeat 120..141 CDD:275380 8/20 (40%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
leucine-rich repeat 166..190 CDD:275380 10/23 (43%)
IQ 581..599 CDD:197470
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 40/119 (34%)
leucine-rich repeat 63..84 CDD:275380
leucine-rich repeat 85..106 CDD:275380 5/17 (29%)
leucine-rich repeat 107..128 CDD:275380 7/20 (35%)
leucine-rich repeat 129..150 CDD:275380 3/20 (15%)
PPP1R42 132..317 CDD:455733 46/135 (34%)
leucine-rich repeat 151..172 CDD:275380 6/20 (30%)
leucine-rich repeat 173..194 CDD:275380 10/20 (50%)
leucine-rich repeat 195..216 CDD:275380 8/20 (40%)
leucine-rich repeat 217..238 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.