DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and CG14995

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_728935.1 Gene:CG14995 / 38487 FlyBaseID:FBgn0035497 Length:454 Species:Drosophila melanogaster


Alignment Length:528 Identity:107/528 - (20%)
Similarity:179/528 - (33%) Gaps:191/528 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSH 187
            ||...:.:..:|.:..:|.::.|.|..|:::.|...:.|  |.|:.|.|.||||:|:|||..|.:
  Fly    24 LNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFEDC--TKLQELYLRKNSISDINEIAYLQN 86

  Fly   188 LSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYID---------------GFVVDPIES 237
            |.:|.::.:.:|||....    |.:||..||....:||.:|               |.|..|.:.
  Fly    87 LPSLRNLWLEENPCCERA----GPNYRSIVLRALPNLKKLDNVEVTQQEVEDALRGGGVAAPEDE 147

  Fly   238 LKAEWLYSQGRGRQFRVGEQQGLAKYLSSVCPLVGKALENENDRKLRLILSKAQH---------H 293
            :..:....|.:.|  |...||                           ||.:.||         .
  Fly   148 VYEDAYQQQQQSR--RSSPQQ---------------------------ILQQQQHSYPQHSPPPQ 183

  Fly   294 QRQLQEEIMDNANSSASTSPSSHRKKPTSRIQSPRFSRLSGRQGSPESMVNSYHGNSSNNSIVSD 358
            |:..|::..........|:|:   |:|      |:.         |..:|.    |||..|| |.
  Fly   184 QQYQQQQQQQQQQQRGCTTPT---KEP------PQL---------PSPLVK----NSSEGSI-SH 225

  Fly   359 NGSTNHSLQMSISLIENIKNDGEGFSLAG--------------SGMSSSVTTK---TYNSTESTP 406
            :.|..:.:|.:             ..|.|              |.|.:::|.:   :|:..:.:|
  Fly   226 SASDLYQVQAA-------------QPLKGSQPPTPTKEPVHPPSPMYNTITKEQRTSYHQYDRSP 277

  Fly   407 ---RNITPNPYNDQTFISQTPSGGPLAAASKMVPVPETLMSPDVCPAAVAQ-RVTVTALN----- 462
               :..:|:.|.:   :..||....::|.|    :.|...|..  ||..|. |.:.|.|.     
  Fly   278 GSDQESSPHTYRE---VRPTPFPPSISAHS----MKEYYQSDR--PAYPAHYRHSQTDLTEWEEH 333

  Fly   463 ---PQLHKTKINKNKDNKLNLPRVRSPQLKRNQSPTSSPRRMANKCSADNMQAPEKLQQSAVLAD 524
               ||:|.......|       ::..|| :|:..|..:|.|                        
  Fly   334 QQVPQVHHNPYGSQK-------QLHQPQ-RRSAGPEMTPYR------------------------ 366

  Fly   525 SGGFSTDDDGEQINIEKLRAIRKMAAQKQQQMHQEQLKQQVDNNLNCQDRLIEHVTESSAVTIQK 589
             .|.:.::.||....::.||.|........                         |.|.:.::..
  Fly   367 -NGSARENGGEWDPEDRSRARRPEGRYSDG-------------------------TSSLSASVMN 405

  Fly   590 MWRGYHTR 597
            .:.|||.|
  Fly   406 HYSGYHRR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380
leucine-rich repeat 32..53 CDD:275380
LRR_RI <49..189 CDD:238064 22/65 (34%)
LRR_4 76..115 CDD:289563
leucine-rich repeat 76..97 CDD:275380
LRR_8 97..152 CDD:290566 7/28 (25%)
LRR_4 97..137 CDD:289563 3/13 (23%)
leucine-rich repeat 98..119 CDD:275380
leucine-rich repeat 120..141 CDD:275380 3/17 (18%)
LRR_8 140..200 CDD:290566 21/59 (36%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
leucine-rich repeat 166..190 CDD:275380 13/23 (57%)
IQ 581..599 CDD:197470 5/17 (29%)
CG14995NP_728935.1 leucine-rich repeat 21..42 CDD:275378 3/17 (18%)
LRR_8 41..99 CDD:290566 21/59 (36%)
leucine-rich repeat 43..64 CDD:275378 5/22 (23%)
LRR_4 44..82 CDD:289563 16/39 (41%)
LRR_RI <56..>123 CDD:238064 27/72 (38%)
leucine-rich repeat 65..89 CDD:275378 13/23 (57%)
leucine-rich repeat 90..118 CDD:275378 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.