DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and TbCMF46

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster


Alignment Length:161 Identity:48/161 - (29%)
Similarity:82/161 - (50%) Gaps:18/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQDDAHSIRQL-----------ILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLRE 78
            |:.:|..:.||           .|:...:.:||::.....:..|.|..|::..:..:..|..|::
  Fly    51 KKGEARRLHQLEPVVYDRITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKD 115

  Fly    79 LNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLR--- 140
            ||||||.|..||.|::.:.|..|:|..|.|:.||:::|..||..|::.:|.|.::..:..||   
  Fly   116 LNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVS 180

  Fly   141 NLKELYLHGNRLTHLRQCDKCLPTSLETLTL 171
            :||.|.|.||.:.  :|.|  .|.||..:.:
  Fly   181 SLKVLNLEGNPIA--KQPD--FPLSLYVIAI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 2/5 (40%)
leucine-rich repeat 32..53 CDD:275380 5/31 (16%)
LRR_RI <49..189 CDD:238064 41/126 (33%)
LRR_4 76..115 CDD:289563 18/38 (47%)
leucine-rich repeat 76..97 CDD:275380 11/20 (55%)
LRR_8 97..152 CDD:290566 21/57 (37%)
LRR_4 97..137 CDD:289563 13/39 (33%)
leucine-rich repeat 98..119 CDD:275380 8/20 (40%)
leucine-rich repeat 120..141 CDD:275380 6/23 (26%)
LRR_8 140..200 CDD:290566 12/35 (34%)
leucine-rich repeat 142..165 CDD:275380 9/22 (41%)
leucine-rich repeat 166..190 CDD:275380 1/6 (17%)
IQ 581..599 CDD:197470
TbCMF46NP_609325.2 leucine-rich repeat 69..90 CDD:275378 3/20 (15%)
LRR_8 89..145 CDD:290566 19/55 (35%)
LRR_4 89..131 CDD:289563 15/41 (37%)
leucine-rich repeat 91..112 CDD:275378 4/20 (20%)
leucine-rich repeat 113..134 CDD:275378 11/20 (55%)
LRR_8 134..192 CDD:290566 21/57 (37%)
LRR_4 134..174 CDD:289563 13/39 (33%)
leucine-rich repeat 135..156 CDD:275378 8/20 (40%)
leucine-rich repeat 157..181 CDD:275378 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45973
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.