| Sequence 1: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006716601.2 | Gene: | DNAAF11 / 23639 | HGNCID: | 16725 | Length: | 472 | Species: | Homo sapiens |
| Alignment Length: | 241 | Identity: | 66/241 - (27%) |
|---|---|---|---|
| Similarity: | 103/241 - (42%) | Gaps: | 56/241 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 71 CRLHCLRELNLSFNGILSIEGL-KECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSIS 134
Fly 135 DMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADN 199
Fly 200 PCVTMINSLDGFD-YRPFVLNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQFRVGEQQGLAKY 263
Fly 264 LSSVCPLVGKALENENDRKLRLILSKAQHHQRQLQEEIMDNANSSA 309 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | |
| leucine-rich repeat | 32..53 | CDD:275380 | |||
| LRR_RI | <49..189 | CDD:238064 | 35/118 (30%) | ||
| LRR_4 | 76..115 | CDD:289563 | 15/39 (38%) | ||
| leucine-rich repeat | 76..97 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 97..152 | CDD:290566 | 15/54 (28%) | ||
| LRR_4 | 97..137 | CDD:289563 | 15/39 (38%) | ||
| leucine-rich repeat | 98..119 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 120..141 | CDD:275380 | 8/20 (40%) | ||
| LRR_8 | 140..200 | CDD:290566 | 12/59 (20%) | ||
| leucine-rich repeat | 142..165 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 166..190 | CDD:275380 | 9/23 (39%) | ||
| IQ | 581..599 | CDD:197470 | |||
| DNAAF11 | XP_006716601.2 | LRR_RI | <5..200 | CDD:238064 | 63/229 (28%) |
| leucine-rich repeat | 29..51 | CDD:275378 | 8/21 (38%) | ||
| LRR_8 | 52..104 | CDD:290566 | 20/75 (27%) | ||
| LRR_4 | 52..92 | CDD:289563 | 16/58 (28%) | ||
| leucine-rich repeat | 52..73 | CDD:275378 | 7/20 (35%) | ||
| leucine-rich repeat | 74..95 | CDD:275378 | 10/39 (26%) | ||
| leucine-rich repeat | 96..120 | CDD:275378 | 9/23 (39%) | ||
| LRRcap | 134..152 | CDD:197729 | 8/17 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R8601 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||