DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and F09G8.5

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_498812.2 Gene:F09G8.5 / 184268 WormBaseID:WBGene00017320 Length:461 Species:Caenorhabditis elegans


Alignment Length:491 Identity:99/491 - (20%)
Similarity:159/491 - (32%) Gaps:178/491 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELYLHGNRL 152
            |:|.:|:      |||.|..|..|:.......||.|:|:.|.:.|::.:.:.:||||:||.    
 Worm   116 SLENVKK------LNLWGCGIDDIQVCEKMSLLEVLSLSVNEVKSLAPLQHCKNLKEVYLR---- 170

  Fly   153 THLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTMINSLDGFDYRPFV 217
                                ||.:..|:|:..|..|.||.::.|.:||||    ...|.:||..|
 Worm   171 --------------------KNCLESLDELEYLKELPNLRTLWIDENPCV----GEGGQEYRRKV 211

  Fly   218 LNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQFRVGEQQGLAKYLSSVCPLVGKALENENDRK 282
            :....:|..:|...|...:                                              
 Worm   212 IRVLPNLTKLDDKPVTTTD---------------------------------------------- 230

  Fly   283 LRLILSKAQHHQRQLQEEIMDNANSSASTSPSSHRKKPTSRIQSPRFSRLSGRQGSPESMVNS-Y 346
                      ||..:::.|                  |...:.:..:|..|.|..|.:.|..| |
 Worm   231 ----------HQEAIEDSI------------------PECDMHNSHYSARSNRSNSIDLMSRSLY 267

  Fly   347 HGNSSNNSIVSDN----GSTNHSLQMSISLIENIKNDGEGFSLAGSGMS-SSVTTKTYNSTESTP 406
            .|.:..:.||...    |.|:..        |........||:...|:. :...|..|  .:|.|
 Worm   268 VGPTVVDRIVQPQLLHFGDTSDE--------ERTTYPARSFSVEVPGLPLTEDHTTVY--LDSAP 322

  Fly   407 RNITPNPYNDQTFISQTPSG---GPLAAASKMVPVPETLMSPD--------------VCPAAVAQ 454
            ::...:.:|   .:||:..|   |.||..      |.:....|              ..|.|.:.
 Worm   323 QSHIGSRHN---LMSQSMYGTLCGTLAEE------PSSADGEDDWNDFSIEEDRVMVQMPLAASH 378

  Fly   455 RVTVTALNPQLHKTKINKNK-----DNKLNLPRVRSPQLKRNQSPTSSPR--RMANKCSADNMQA 512
            |     :...:|:..:.:.|     ...:::||.|:..|....|..|..|  |:....||     
 Worm   379 R-----MYQSMHEGMVIEMKRPPVYGRSVSMPRRRATNLTTRASSMSPAREQRLTKIMSA----- 433

  Fly   513 PEKLQQSAVLADSGGFSTDDDG-EQINIEKLRAIRK 547
                  .:||.|    ..|.|| .|:..|..|.::|
 Worm   434 ------VSVLLD----ELDTDGLRQVVDEAQRRLKK 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380
leucine-rich repeat 32..53 CDD:275380
LRR_RI <49..189 CDD:238064 26/100 (26%)
LRR_4 76..115 CDD:289563 9/26 (35%)
leucine-rich repeat 76..97 CDD:275380 3/8 (38%)
LRR_8 97..152 CDD:290566 18/54 (33%)
LRR_4 97..137 CDD:289563 12/39 (31%)
leucine-rich repeat 98..119 CDD:275380 6/20 (30%)
leucine-rich repeat 120..141 CDD:275380 6/20 (30%)
LRR_8 140..200 CDD:290566 15/59 (25%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
leucine-rich repeat 166..190 CDD:275380 6/23 (26%)
IQ 581..599 CDD:197470
F09G8.5NP_498812.2 LRR_4 118..160 CDD:289563 14/47 (30%)
LRR_4 142..181 CDD:289563 16/62 (26%)
leucine-rich repeat 142..163 CDD:275382 6/20 (30%)
leucine-rich repeat 164..187 CDD:275382 10/46 (22%)
leucine-rich repeat 189..217 CDD:275382 10/31 (32%)
LRRcap 205..222 CDD:197729 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.