Sequence 1: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495653.1 | Gene: | sds-22 / 174266 | WormBaseID: | WBGene00011637 | Length: | 326 | Species: | Caenorhabditis elegans |
Alignment Length: | 268 | Identity: | 70/268 - (26%) |
---|---|---|---|
Similarity: | 123/268 - (45%) | Gaps: | 46/268 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 SIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKEC 95
Fly 96 IHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCDK 160
Fly 161 CLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLK 225
Fly 226 YIDGFVVDPIESLKAEWLYSQGRGRQFRVGEQQGLAKYLSSVCPLVGKALE---------NENDR 281
Fly 282 KLRLILSK 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | 70/268 (26%) |
leucine-rich repeat | 32..53 | CDD:275380 | 7/20 (35%) | ||
LRR_RI | <49..189 | CDD:238064 | 39/139 (28%) | ||
LRR_4 | 76..115 | CDD:289563 | 16/38 (42%) | ||
leucine-rich repeat | 76..97 | CDD:275380 | 8/20 (40%) | ||
LRR_8 | 97..152 | CDD:290566 | 20/54 (37%) | ||
LRR_4 | 97..137 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 98..119 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 140..200 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 142..165 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 166..190 | CDD:275380 | 5/23 (22%) | ||
IQ | 581..599 | CDD:197470 | |||
sds-22 | NP_495653.1 | leucine-rich repeat | 40..59 | CDD:275380 | |
leucine-rich repeat | 60..82 | CDD:275380 | 70/268 (26%) | ||
LRR_8 | 82..137 | CDD:290566 | 16/54 (30%) | ||
LRR_4 | 83..123 | CDD:289563 | 11/39 (28%) | ||
leucine-rich repeat | 83..104 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 104..144 | CDD:289563 | 12/39 (31%) | ||
leucine-rich repeat | 105..126 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 125..181 | CDD:290566 | 21/55 (38%) | ||
LRR_4 | 125..167 | CDD:289563 | 16/41 (39%) | ||
leucine-rich repeat | 127..148 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 149..170 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 171..192 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 193..214 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 215..236 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 256..283 | CDD:275380 | 7/27 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |