DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and CNTRL

DIOPT Version :9

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_011516468.1 Gene:CNTRL / 11064 HGNCID:1858 Length:2340 Species:Homo sapiens


Alignment Length:860 Identity:169/860 - (19%)
Similarity:319/860 - (37%) Gaps:257/860 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DESGEEKH--VLNLSKQKLKKVPKQDDAHSIRQLILD-----ENELQKIDNIDSYLKIETLSLAR 61
            |..|.:.|  |..:::..:||:.|||:...|:.|.|.     ..:.:.|:|::..:|:|.|:|:.
Human    70 DHKGADSHAGVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIENLEKCVKLEVLNLSY 134

  Fly    62 NQLLRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLA 126
            |.:.::..:.:|..|||||||:|.|..|||::...:|:.|||.||.   |||:            
Human   135 NLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNE---IEHI------------ 184

  Fly   127 DNSIGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNL 191
                             .::| |.:|           .||..|.|..|.|:.|.:|..|..|.:|
Human   185 -----------------PVWL-GKKL-----------KSLRVLNLKGNKISSLQDISKLKPLQDL 220

  Fly   192 LSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQFRVGE 256
            :|:.:.:||.||:          |..|.:.:       |.:..:|||:.:.:.:|.|...|   |
Human   221 ISLILVENPVVTL----------PHYLQFTI-------FHLRSLESLEGQPVTTQDRQEAF---E 265

  Fly   257 QQGLAKYLSSVCPLVGKALENENDRKLRLILSKAQHHQRQLQEEI--MDNANSSASTSPSSHRKK 319
            :..|.:.         :.||.:.::|: :...:.:..|.:..|||  .|..|.|.          
Human   266 RFSLEEV---------ERLERDLEKKM-IETEELKSKQTRFLEEIKNQDKLNKSL---------- 310

  Fly   320 PTSRIQSPRFSRLSGRQGSPESMVNSYHGNSSNNSIVSDNGSTNHSL-QMSISLIENIKNDGEGF 383
                              ..|:|:.    ..|...:.||..:.|..| |.:|.|           
Human   311 ------------------KEEAMLQ----KQSCEELKSDLNTKNELLKQKTIEL----------- 342

  Fly   384 SLAGSGMSSSVTTKTYN----------STESTPRNITPNPYNDQTFISQTPSGGPLAAASKMVPV 438
                    :....|.|.          ..:..|.|..|:.|.:   |.:.|...|....|:   .
Human   343 --------TRACQKQYELEQELAFYKIDAKFEPLNYYPSEYAE---IDKAPDESPYIGKSR---Y 393

  Fly   439 PETLMSPDVCPAAVAQRVTVTALNP--QLHKTKIN-----------KNKDNKLNLPRVRSPQLKR 490
            ...:.:.:......||.|.:..:.|  ||....:|           ::|:.|::..:.|..:|  
Human   394 KRNMFATESYIIDSAQAVQIKKMEPDEQLRNDHMNLRGHTPLDTQLEDKEKKISAAQTRLSEL-- 456

  Fly   491 NQSPTSSPRRMANKCSADNMQAPEKLQQSAVLADSGGFSTDDDGEQI-------NIEKLRAIRKM 548
             ........:...:.:.:..|..|.:|...:         .:.|:.:       .::.:..:|:.
Human   457 -HDEIEKAEQQILRATEEFKQLEEAIQLKKI---------SEAGKDLLYKQLSGRLQLVNKLRQE 511

  Fly   549 AAQKQQQMHQEQLKQQVD-------------NNLNCQDRLIEHVTESSAVTIQKMWRGYHTRKKT 600
            |...:.||  |:.||::.             ::|:.:|....|:            :...:.|:.
Human   512 ALDLELQM--EKQKQEIAGKQKEIKDLQIAIDSLDSKDPKHSHM------------KAQKSGKEQ 562

  Fly   601 NKDIAERLQRR---RTQEYIEQLGKDMLLTKAQLENERKIQQLQMQAINALWKKVSTMEVDPKGI 662
            ..||..:..::   |..|.:.::.|:   |:...:.|.::.:.|:.|..||.|       |.:|:
Human   563 QLDIMNKQYQQLESRLDEILSRIAKE---TEEIKDLEEQLTEGQIAANEALKK-------DLEGV 617

  Fly   663 PAAAEQGEDSNGGGSGHLSLDQNSAAVVNDLAKRCTMLTDQVQMLQSSIGTIVNCLTMVCNLPQD 727
            .:..   ::..|...|..:..||          .|..|.|:.:       |::..||.|     :
Human   618 ISGL---QEYLGTIKGQATQAQN----------ECRKLRDEKE-------TLLQRLTEV-----E 657

  Fly   728 AIKKQAEII--DCSSTQTDLIAVHTP-QIEDLTNFPFTKTRPSTLALESKHEAALACPKIDELND 789
            ..:.|.||:  |..:.:.:|..:.:. |.:...|....:|:....|.|::.||.|      .|.|
Human   658 QERDQLEIVAMDAENMRKELAELESALQEQHEVNASLQQTQGDLSAYEAELEARL------NLRD 716

  Fly   790 VDLKETQEDSENLDK 804
            .:..:.:|:.|.:.:
Human   717 AEANQLKEELEKVTR 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 7/21 (33%)
leucine-rich repeat 32..53 CDD:275380 5/25 (20%)
LRR_RI <49..189 CDD:238064 39/139 (28%)
LRR_4 76..115 CDD:289563 21/38 (55%)
leucine-rich repeat 76..97 CDD:275380 12/20 (60%)
LRR_8 97..152 CDD:290566 11/54 (20%)
LRR_4 97..137 CDD:289563 9/39 (23%)
leucine-rich repeat 98..119 CDD:275380 9/20 (45%)
leucine-rich repeat 120..141 CDD:275380 0/20 (0%)
LRR_8 140..200 CDD:290566 15/59 (25%)
leucine-rich repeat 142..165 CDD:275380 3/22 (14%)
leucine-rich repeat 166..190 CDD:275380 9/23 (39%)
IQ 581..599 CDD:197470 0/17 (0%)
CNTRLXP_011516468.1 leucine-rich repeat 100..119 CDD:275378 3/18 (17%)
LRR_4 126..167 CDD:289563 18/40 (45%)
leucine-rich repeat 127..148 CDD:275380 5/20 (25%)
LRR_8 148..205 CDD:290566 29/100 (29%)
leucine-rich repeat 149..170 CDD:275380 12/20 (60%)
LRR_4 169..213 CDD:289563 20/87 (23%)
leucine-rich repeat 171..194 CDD:275380 12/66 (18%)
leucine-rich repeat 195..219 CDD:275380 9/23 (39%)
leucine-rich repeat 220..246 CDD:275380 9/42 (21%)
SMC_prok_B <435..1119 CDD:274008 61/364 (17%)
DUF342 <513..610 CDD:302792 18/113 (16%)
Pro-rich <1176..1299 CDD:291893
COG4372 1320..>1602 CDD:226809
Mplasa_alph_rch 1525..2221 CDD:275316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.